Alt Beauty Is Changing the Way India Does Skincare, One Smart Product at a Time
If you’ve ever stood in front of your mirror, wondering why your skincare routine takes longer than your actual breakfast, you’re not alone. Most of us are tired of long 10-step routines, layering serum over serum, and still not seeing the glow we were promised. Skincare has somehow become more stressful than soothing. But now, a new Indian brand is here to change that—say hello to altBeauty.
Alt Beauty isn’t just another skincare label. It was created by someone who knows skin inside out. Dr. Pallavi Ahire-Shelke, an award-winning dermatologist, saw how her busy clients were constantly overwhelmed by confusing ingredients and product overload. That’s why she decided to flip the script. Her idea was simple: why not make skincare smart and simple, not complicated?
What makes Alt Beauty different is how practical and science-backed it is. These are multi-tasking products designed to save you time without cutting corners. Every formula is packed with dermatologist-approved ingredients, safe for Indian skin and the daily lifestyle challenges we all face—like sun, stress, screen-time and pollution.
Let’s talk about the product that’s winning hearts already: the Smart Sunscreen. It’s not your average SPF. This one is completely mineral-based, so it’s gentle and non-toxic. It’s packed with SPF 60 and protects not just against UV rays, but also blue light from screens, IR radiations and harmful pollution. It also has niacinamide, vitamin C and hyaluronic acid built in, so you don’t need a separate moisturizer. Basically, it replaces your sunscreen, moisturizer, antioxidant serum and makeup base—all in one tube. It’s even safe for pregnant women. No white cast, no greasiness, complete daytime skin protection.
Then there’s the Smart Night Gel—a power-packed overnight repair cream that does the work while you sleep. It’s got plant-based retinol, glutathione, peptides, ceramides, AHA-BHA, and more to fight signs of aging, boost hydration, and leave your skin brighter by morning. And if you’re starting your routine, the Clean-n-Tone Cleanser is a game changer. It cleanses, tones and removes makeup in one step. You can even use it without water. Super handy on the go usage.
Alt Beauty products aren’t just multi-purpose—they’re made to be kind to your skin and kind to your time. That’s why more than 1,000 people tried the brand in its very first month. And many of them are already coming back for more. Real customers are saying they’ve finally found skincare that actually fits into their lives—and works.
What’s even more refreshing is the brand’s belief that beauty starts from within. Alt Beauty doesn’t sell filters or perfection. It’s about helping you feel confident, creative and comfortable in your skin. They have a vibrant community which guides skin health with focusing on lifestyle, nutrition, mind and soul and art forms related guidance which could help everyone. Whether you’re someone who’s just starting out or someone who’s tried every product under the sun, Alt Beauty is here to simplify the way you care for your skin.
If you’re tired of spending too much time and money on too many skincare products, this might just be the solution you’ve been waiting for. Smart, efficient, and designed for modern Indian lifestyles—Alt Beauty is the skincare shortcut your busy life needs.
Check it out for yourself at Website and Instagram

Alt Beauty Is Changing the Way India Does Skincare, One Smart Product at a Time
If you’ve ever stood in front of your mirror, wondering why your skincare routine takes longer than your actual breakfast, you’re not alone. Most of us are tired of long 10-step routines, layering serum over serum, and still not seeing the glow we were promised. Skincare has somehow become more stressful than soothing. But now, a new Indian brand is here to change that—say hello to altBeauty.
Alt Beauty isn’t just another skincare label. It was created by someone who knows skin inside out. Dr. Pallavi Ahire-Shelke, an award-winning dermatologist, saw how her busy clients were constantly overwhelmed by confusing ingredients and product overload. That’s why she decided to flip the script. Her idea was simple: why not make skincare smart and simple, not complicated?
What makes Alt Beauty different is how practical and science-backed it is. These are multi-tasking products designed to save you time without cutting corners. Every formula is packed with dermatologist-approved ingredients, safe for Indian skin and the daily lifestyle challenges we all face—like sun, stress, screen-time and pollution.
Let’s talk about the product that’s winning hearts already: the Smart Sunscreen. It’s not your average SPF. This one is completely mineral-based, so it’s gentle and non-toxic. It’s packed with SPF 60 and protects not just against UV rays, but also blue light from screens, IR radiations and harmful pollution. It also has niacinamide, vitamin C and hyaluronic acid built in, so you don’t need a separate moisturizer. Basically, it replaces your sunscreen, moisturizer, antioxidant serum and makeup base—all in one tube. It’s even safe for pregnant women. No white cast, no greasiness, complete daytime skin protection.
Then there’s the Smart Night Gel—a power-packed overnight repair cream that does the work while you sleep. It’s got plant-based retinol, glutathione, peptides, ceramides, AHA-BHA, and more to fight signs of aging, boost hydration, and leave your skin brighter by morning. And if you’re starting your routine, the Clean-n-Tone Cleanser is a game changer. It cleanses, tones and removes makeup in one step. You can even use it without water. Super handy on the go usage.
Alt Beauty products aren’t just multi-purpose—they’re made to be kind to your skin and kind to your time. That’s why more than 1,000 people tried the brand in its very first month. And many of them are already coming back for more. Real customers are saying they’ve finally found skincare that actually fits into their lives—and works.
What’s even more refreshing is the brand’s belief that beauty starts from within. Alt Beauty doesn’t sell filters or perfection. It’s about helping you feel confident, creative and comfortable in your skin. They have a vibrant community which guides skin health with focusing on lifestyle, nutrition, mind and soul and art forms related guidance which could help everyone. Whether you’re someone who’s just starting out or someone who’s tried every product under the sun, Alt Beauty is here to simplify the way you care for your skin.
If you’re tired of spending too much time and money on too many skincare products, this might just be the solution you’ve been waiting for. Smart, efficient, and designed for modern Indian lifestyles—Alt Beauty is the skincare shortcut your busy life needs.
Check it out for yourself at Website and Instagram

दरोगा विद्यासागर के अपराध,काली कमाई ने बेटे को बना दिया अपराधी


  


जौनपुर। बहुत पुरानी कहावत है "कि बाप का खाया बेटा भरता हैं" लेकिन यह कहावत बिल्कुल फिट बैठ रही हैं. थानागद्दी चौकी पर तैनात प्रमोटी दारोगा विद्यासागर सिंह के बेटे आदित्य सागर के खिलाफ पड़ोसी वाराणसी जिले के चोलापुर थाने में गंभीर धाराओं में आरोपी बनाया हैं।

जानकारी के मुताबिक विद्यासागर सिंह सिपाही से प्रोन्नत होकर दरोगा बने। अल्प समय के लिए दरोगा की कुर्सी व कंधे पर सितारे लगते ही शरीर में ऐंठन होने लगी। फिर खाकी में अपराध व अवैध कामों को संरक्षण देकर के धन बटोरने में जुट गया। विभागीय लोग बताते हैं कि विद्यासागर के बेटे बेरोजगार हैं। जिससे विद्यासागर को हरवक्त बेटे को सजोने संवारने में जुट रहता हैं। जिसके लिए हरसंभव प्रयास करके अपराध में धंसता गया। खुद का सिंडिकेट तैयार लिया। जिसमें कुछ तथाकथित पत्रकारों को भी शामिल किया। जिससे किसी भी घटना को दबाते हुए,वसूली को प्रायोजित तरीके से कराई जा सके।

विद्यासागर ने अपराध से अर्जित काली कमाई से एक कृषि कार्य में रजिस्टर्ड ट्रैक्टर UP62AS9996 लिया। जिससे कमर्शियल उपयोग में लेने लगा। ट्रैक्टर को अपराधिक सिंडिकेट के इशारे पर अवैध कामों में धकेल दिया। अवैध व अपराध से अर्जित राशि ने ज्यादा दिन तक विद्यासागर का साथ नहीं दिया। कुछ माह बाद चोलापुर पुलिस ने हिट एंड रन का मामला आदित्य सागर के खिलाफ दर्ज करते हुए,चार्जशीट न्यायालय में भेज दिया।

कप्तान ने कतरे पर,भेजा खेतासराय
अपराध में धंसते जा रहे विद्यासागर को स्थानीय अधिकारियों का प्रश्रय था. जिससे विद्यासागर आराम से अपने कामों को अंजाम दे रहा था। लगातार शिकायतों को देखते हुए,कप्तान ने विद्यासागर का ट्रांसफर खेतासराय कर दिया। ट्रांसफर की बात सुनकर विद्यासागर के होश उड़ गए। अपराधिक सिंडिकेट के साथ विद्यासागर ने कई चौखटों पर माथा टेकते हुए,ट्रांसफर रुकवाने की गुहार की। लेकिन किसी ने नहीं सुनी। चूंकि खेतासराय में अवैध कमाई बंद हो चुकी हैं। सिंडिकेट भी बिखर चुका हैं। विभाग के अनुसार विद्यासागर केराकत थाना क्षेत्र के सरकी चौकी पर आने के लिए हर संभव प्रयास कर रहा हैं। जिससे सिंडिकेट व अपराधिक गतिविधि से काली कमाई की जा सके।

Dr. Ankit Agrawal and i2CAN Skin Care Clinic: A Trusted Name in Dermatology in Delhi and Mathura


New Delhi / Mathura: When it comes to skin and hair care, people today are looking for experts they can truly trust. That’s where Dr. Ankit Agrawal, a renowned dermatologist and cosmetologist, steps in with his advanced and patient-friendly approach. Heading the i2CAN Skin Care Clinic, Dr. Agrawal has become a well-known name in both Delhi and Mathura, offering top-quality skincare services to thousands of satisfied patients. The i2CAN Skin Care Clinic, located at 1st Floor, Near Shalimar Palace, Kaushik Enclave, Burari, New Delhi, serves as a hub for advanced skincare solutions. The clinic has also extended its presence to Mathura, allowing more people to benefit from expert consultation and cutting-edge treatments. Strategically located in these two cities, i2CAN is becoming the preferred choice for people seeking reliable and result-oriented dermatological care.



Under the leadership of Dr. Agrawal, i2CAN Skin Care Clinic has grown into a top-notch institute, offering a comprehensive range of skin and hair treatments. The clinic blends medical excellence with advanced technologies, ensuring that patients receive modern, effective, and personalized care. Whether the concern is acne, pigmentation, hair fall, skin allergies, or aesthetic enhancements like PRP therapy, laser hair reduction, or anti-aging procedures, patients can expect solutions tailored to their individual needs.





Dr. Ankit Agrawal is known for his hands-on approach, attention to detail, and deep understanding of dermatological conditions. He is appreciated not just for his professional knowledge but also for his genuine care and honest advice. Patients across Delhi and Mathura often speak highly of his clear communication style, gentle manner, and dedication to achieving visible, long-lasting results. He also emphasizes educating patients about their skin type, condition, and how to maintain healthy skin beyond the clinic.





What sets i2CAN Skin Care Clinic apart is its well-rounded team. The clinic is home to trained professionals who assist Dr. Agrawal in delivering high-quality services with consistency and compassion. Every member of the team is committed to maintaining the clinic’s standards of hygiene, patient comfort, and timely service. This combination of expertise and hospitality is a big reason why i2CAN has grown rapidly in popularity and trust.





In terms of infrastructure, the clinic features a modern, welcoming environment equipped with the latest diagnostic and therapeutic tools. The clinic also adheres strictly to safety protocols and international standards, making it a safe and comfortable space for both first-time and regular visitors. From the moment a patient steps in until the completion of their treatment, they are guided and supported at every step.





The clinic’s growing patient base is also a result of its transparent pricing and flexible treatment plans. By keeping services affordable without compromising on quality, i2CAN Skin Care Clinic makes professional dermatological care accessible to a wider community. This approach is particularly appreciated in areas like Burari and Mathura, where high-end skincare services were previously limited.





Dr. Agrawal has long-term plans to expand the clinic’s services across Delhi NCR and parts of Uttar Pradesh, reaching more people who deserve top-quality skincare. His mission is simple—to make people feel confident and comfortable in their own skin. With his knowledge, experience, and a great team behind him, he is well on his way to achieving it.
https://www.instagram.com/iicandelhi/
https://mathura.iicanpune.in/

If you’re searching for a dermatologist you can trust, i2CAN Skin Care Clinic offers everything you need—experience, technology, compassion, and consistent results. Whether you live in North Delhi, Kaushik Enclave, or Mathura, Dr. Ankit Agrawal’s clinic is just around the corner, ready to help you look and feel your best.

  *Fortress vs Flair as Mohun Bagan Super Giant lock horns with Bengaluru FC in a blockbuster title clash*
Sports 

 ISL 
 


 Kolkata : Mohun Bagan Super Giant (MBSG) will face Bengaluru FC in the final of the Indian Super League (ISL) 2024-25 at the Vivekananda Yuba Bharati Krirangan (VYBK) on April 12, at 7:30 PM IST in a blockbuster winner takes all clash befitting of a much awaited title clash.

Speaking at the pre-match press conference in Kolkata ahead of the final, Mohun Bagan Super Giant Head Coach Jose Molina stressed on the importance of looking forward and not worrying about the past. “I don’t care about what happened in the past. I am trying to do my best for Mohun Bagan Super Giant. We did well to win the League Shield and we are motivated to win the ISL Cup too. I don’t need extra motivation from the fact that we lost the final last year. We are already motivated enough.”

Bengaluru FC Head Coach Gerard Zaragoza, who showed exemplary camaraderie by helping a translate a question for his counterpart Molina, was chuffed about playing the big final in Kolkata. “We are very motivated for the finals and excited for the game. Everything is fine. We are confident and Kolkata is almost like our second home, because we were here for the Durand Cup. We had a good playoffs and we are looking forward to the grand finale.”

His sentiment was echoed by BFC goalkeeper Gurpreet Singh Sandhu, who spoke fondly about his long association with the city. “As you know, my journey as a professional footballer started here and I was very lucky to be getting opportunities to play matches from the beginning. I am grateful for the journey. If you get an opportunity to play big games, big finals, in front of big crowds as a player, it’s a great experience and I am lucky to be here for the match in Kolkata.” Gurpreet also reserved some special praise for the opponents, saying, “Mohun Bagan Super Giant have been the standout team this season and there is no denying that, which is why they won the League Shield.”

Mohun Bagan Super Giant captain Subhasish Bose, who Molina jokingly referred to as a striker in light of his goalscoring form in this edition, shed light on the significance of the venue as a local boy. “I am always thrilled to play in front of our home fans. I wish that the fans support us wholeheartedly against Bengaluru FC tomorrow.”

MBSG are the League Shield Winners, whereas Bengaluru FC finished third in the standings and then cruised past the challenges that fronted them in the eliminator and semi-final to make it to the summit clash.

It is a fourth ISL finals appearance for BFC in just 8 seasons, while MBSG have become the first team to reach this stage three successive times. This fixture is an encore of the ISL 2022-23 showdown, when both these sides had clashed in the season finale, with the Kolkata-based team emerging triumphant via penalties in a very tight contest.

They have the chance to repeat that feat in front of a vociferous home crowd this time around, whereas Bengaluru FC will take confidence from their recent form to distort MBSG’s record of staying unbeaten at home thus far in the current campaign.
 Pic : Sanjay Hazra (khabar kolkata).

अमेरिका में क्यों कैंसिल हो रहा स्टूडेंट वीजा? भारत के 3 लाख स्टूडेंट्स की बढ़ी परेशानी
#whyusstudentvisacancelled


टैरिफ वॉर के बीच अमेरिका में अब विदेशी छात्रों की परेशानी बढ़ गई है। ट्रंप की सरकार में इमिग्रेशन नीतियों को कड़ा किया गया है। सैकड़ों छात्रों को स्टूडेंट वीजा रद्द कर उन्हें डिपोर्ट किया गया है। अमेरिका में पढ़ने वाले भारतीय छात्रों पर भी एक्शन लिया गाय है। मौजूदा सरकार की नीतियों की वजह विदेशी छात्रों और यूनिवर्सिटीज दोनों की परेशानी बढ़ गई है। 

अमेरिका में पढ़ाई कर रहे छात्रों के F-1 वीजा को मामूली अपराधों के आधार पर रद्द करना शुरू कर दिया है। इनमें ट्रैफिक नियमों का उल्लंघन, डिंक एंड ड्राइव, ओवर स्पीडिंग और शॉप-लिफ्टिंग जैसे अपराध शामिल हैं। सिर्फ इतना ही नहीं, बल्कि फिलिस्तीन समर्थक बयानबाजी, विरोध-प्रदर्शन और सोशल मीडिया पर पोस्टिंग को लेकर भी वीजा कैंसिल हुए हैं। अधिकारी आव्रजन और राष्ट्रीयता अधिनियम के तहत शायद ही कभी इस्तेमाल की जाने वाली शक्तियों का इस्तेमाल कर रहे हैं। इससे छात्र अनिश्चितता में हैं।

वीजा कैंसिल होने से स्टूडेंट परेशान
अमेरिकी राष्ट्रपति ट्रंप की वजह से दुनिया में नया टैरिफ वॉर छिड़ गया है। इससे सभी देश पहले ही परेशान हैं। अब ट्रंप सरकार ने जिस तरह से छात्रों के खिलाफ रुख अपनाया है उसने एक नई समस्या को जन्म दे दिया है। अमेरिका ने दुनिया के कई छात्रों को अमेरिका छोड़ने की हिदायत दी है, इनमें भारतीय छात्र भी शामिल हैं। इनका वीजा रद्द कर दिया गया है और मेल भेजकर इन्हें इस बात की जानकारी भी दे दी गई है। इनसे कह दिया गया है कि वह खुद डिपोर्ट हो जाएं।
कई छात्रों ने दावा किया कि उनकी पुरानी गलतियों को आधार बना जा रहा है, जिनकी सभी कानूनी कार्रवाई पूरी हो चुकी हैं। एक छात्र ने बताया कि उसने 2 साल पहले स्पीडिंग का उल्लंघन किया था और जुर्माना भर दिया था। एक अन्य ने शराब पीकर गाड़ी चलाने के बाद सभी शर्तें पूरी की थीं।

वीजा पर नई नीति काफी सख्त
अमेरिका ने हाल ही में वीजा के लिए एक नया नियम बनाया था। अमेरिका में F-1 , M-1 और J-1 वीजा दिए जाते हैं, जिन्हें स्टूडेंट वीजा के तौर पर जाना जाता है। इस वीजा के जरिए स्टूडेंट्स अमेरिका के कॉलेजों और यूनिवर्सिटीज में पढ़ने जाते हैं। स्टूडेंट वीजा विदेश विभाग द्वारा जारी किया जाता है। छात्रों को फुल-टाइम स्टूडेंट के तौर पर पढ़ने के लिए वीजा मिलता है। वीजा मिलने के बाद उन्हें सख्त नियमों का पालन करना होता है। पहले किसी का वीजा रद्द होने पर भी उन्हें पढ़ने की इजाजत थी, लेकिन नई नीतियों के बाद अब उन्हें तुरंत देश छोड़ना होगा।

वीजा अप्लाई करने वालों के सोशल मीडिया अकाउंट पर नजर
यूएस सेक्रेटरी ऑफ स्टेट मार्को रुबियो ने खुद ये बताया था कि मार्च से अमेरिका में वीजा के लिए अप्लाई करने वालों का सोशल मीडिया अकाउंट भी खंगाला जाएगा। इसका उद्देश्य ये था कि जिन लोगों ने किसी भी तरह इजराइल या अमेरिका की सोशल मीडिया पर आलोचना की है उन्हें अमेरिका आने से रोका जा सके। इसके अलावा रूबियो ने अमेरिका में पढ़ रहे विदेशी छात्रों के सोशल मीडिया अकाउंट पर भी नजर रखने को कहा था। इसके बाद से अमेरिका में वीजा रद्द करने का काम तेजी पकड़ चुका है।

क्या है बिम्सटेक, जिसके समिट में शामिल होने बैंकॉक पहुंचे पीएम मोदी, भारत के लिए क्यों जरूरी
#whatisbimstecandwhyisitsignificantfor_india
प्रधानमंत्री नरेंद्र मोदी गुरुवार को थाईलैंड की राजधानी बैंकॉक पहुंचे। पीएम मोदी बंगाल इनिशिएटिव फॉर सेक्टोरल टेक्निकल एंड इकोनॉमिक कोऑपरेशन यानि बिम्सटेक के शिखर सम्मेलन में शामिल होंने बैंकॉक पहुंचे हैं।कल यह सम्मेलन होना है।वहीं, विदेश मंत्री एस जयशंकर पहले से ही बैंकॉक में हैं। उन्होंने आज 20वीं बिम्सटेक मंत्रिस्तरीय बैठक में भाग लिया। ऐसे में सवाल उठता है कि बिम्सटेक क्या है और यह भारत के लिए क्यों इतना जरूरी है कि पीएम मोदी और एस जयशंकर इस बैठक में हिस्सा लेने के लिए बैंकॉक पहुंचे हैं।

बिम्सटेक क्या है?
बिम्सटेक यानी बंगाल की खाड़ी बहु-क्षेत्रीय तकनीकी और आर्थिक सहयोग पहल है। यह एक क्षेत्रीय संगठन है जिसमें बंगाल की खाड़ी के आसपास स्थित सात सदस्य देश शामिल हैं। इस उप-क्षेत्रीय संगठन की स्थापना 6 जून 1997 को बैंकॉक घोषणा के माध्यम से की गई थी। सात सदस्य देशों में दक्षिण एशिया के पांच देश- बांग्लादेश, भूटान, भारत, नेपाल और श्रीलंका- और दक्षिण-पूर्व एशिया के दो देश- म्यांमार और थाईलैंड शामिल हैं। मूल रूप से, इस ब्लॉक की शुरुआत चार सदस्य देशों के साथ हुई थी, जिसका नाम 'BIST-EC' (बांग्लादेश, भारत, श्रीलंका और थाईलैंड आर्थिक सहयोग) था।

क्या है संगठन का मुख्य उद्देश्य?
संगठन का मुख्य उद्देश्य बंगाल की खाड़ी से जुड़े देशों की आर्थिक तरक्की, आपसी सहयोग, क्षेत्रीय चुनौतियों से मिलकर निपटने की नीति, आपसी हितों पर विचार-विमर्श करना आदि था। सहयोग और समानता की भावना पैदा करने के साथ ही शिक्षा, विज्ञान-तकनीक के क्षेत्र में एक-दूसरे की खुलकर मदद करना भी इसके उद्देश्यों में शामिल है। समान संप्रभुता, क्षेत्रीय अखंडता, राजनीतिक स्वतंत्रता, आंतरिक मामलों में हस्तक्षेप न करना, शांतिपूर्ण श-अस्तित्व, पारस्परिक लाभ, सदस्य देशों के बीच अन्य द्विपक्षीय, क्षेत्रीय एवं बहुपक्षीय सहयोग जैसे मुद्दे भी इस महत्वपूर्ण संगठन के प्रमुख सिद्धांतों में शामिल किये गए हैं।

दुनिया के लिए क्यों महत्वपूर्ण है बिम्सटेक?
दुनिया के लिए भी यह बेहद महत्वपूर्ण है। मीडिया रिपोर्ट की मानें तो दुनिया की कुल आबादी का 22 फीसदी से ज्यादा हिस्सा इन्हीं सात देशों में निवास करता है। दुनिया के कुल व्यापार का एक चौथाई से ज्यादा हिस्सा बंगाल की खाड़ी से होकर गुजरता है। सदस्य देशों की संयुक्त जीडीपी लगभग 4 ट्रिलियन अमेरिकी डॉलर बताई जाती है।ये आंकड़े यह बताने को काफी हैं कि दुनिया के लिए यह संगठन और इसके सदस्य देश कितने महत्वपूर्ण हैं। 
बिम्सटेक की पहल पर कुछ महत्वपूर्ण परियोजनाओं पर काम हुआ, जिसका सीधा लाभ सदस्य देशों को मिल रहा है। इनमें भारत और म्यांमार को जोड़ने वाली कलादान मल्टी मॉडल परियोजना, म्यांमार से होकर भारत और थाईलैंड को जोड़ने वाली एशियाई त्रिपक्षीय राजमार्ग तथा यात्री एवं माल परिवहन के सुगम प्रवाह हेतु बांग्लादेश-भारत-भूटान-नेपाल मोटर वाहन समझौता शामिल है।

दिशा सालियान मौत मामले में क्यों आ रहा आदित्य ठाकरे का नाम? महाराष्ट्र में नया सियासत बवाल
#dishasaliandeathcaseadityathackeraynamewhyinvolved
दिशा सालियान मर्डर केस एक बार फिर सुर्खियों में है। 8 जून 2020 को दिशा की मौत हुई। इसके 6 दिन एक्टर सुशांत सिंह राजपूत की लाश उनके कमरे में मिली। दिशा सुशांत की मैनेजर रह चुकी थी। दिशा की मौत का केस इस बार सुर्खियों में इसलिए आया, क्योंकि उसके पिता सतीश ने बेटी की मौत की नए एंगल से जांच करने की मांग की है। हालांकि 5 साल पहले सतीश ने दिशा की मौत को सुसाइड मान लिया था, लेकिन अब उनका कहना है कि उन्हें सुसाइड मानने के लिए मजबूर किया गया था।

दिशा के पिता सतीश सालियान ने अपनी बेटी की मौत की नए सिरे से जांच की मांग करते हुए बॉम्बे हाईकोर्ट का रुख किया है और आदित्य ठाकरे के खिलाफ एफआईआर दर्ज करने की मांग की है। उन्होंने याचिका में दिशा सालियान के अंतिम संस्कार की तस्वीरों को भी अदालत में अपनी याचिका के साथ अटैच किया है। इस याचिका में वकील का कहना है कि जब दिशा का पार्थिव शरीर उसके परिवार को सौंपा गया, तब उसके शरीर पर किसी भी चोट या घाव के निशान नहीं थे, जबकि मालवणी पुलिस ने दावा किया था कि दिशा की मौत के समय उसका शरीर खून से लथपथ था।

दिशा की मौत मामले में आदित्य ठाकरे का नाम आ रहा है।सतीश सालियान ने कोर्ट में याचिका दायर कर आदित्य ठाकरे समेत कई लोगों पर गंभीर आरोप लगाए हैं। आदित्य ठाकरे और पूर्व मेयर किशोरी पेडनेकर के खिलाफ मामला दर्ज करने की मांग की गई है। दिशा सालियान के पिता ने बेटी की हत्या का दावा करते हुए आदित्य ठाकरे, एक्टर सूरज पंचोली और डिनो मोर्या पर गंभीर आरोप लगाए हैं। उन्होंने ये भी कहा है कि मुंबई पुलिस ने हकीकत को छुपाने की कोशिश की है। सतीश सालियान ने आदित्य ठाकरे पर ये भी आरोप लगाया है कि सुशांत सिंह राजपूत की मौत के बाद उन्होंने रिया चक्रवर्ती से 44 बार फोन पर फोन किया था।

परिवार को नजरबंद रखने का आरोप
सतीश सालियान ने याचिका में कहा है कि दिशा की मौत अचानक नहीं हुई। पहले उनके साथ गैंगरेप हुआ और फिर उनका मर्डर कर दिया गया। सतीश ने कहा-'दिशा अपने करियर को लेकर काफी सीरियस थीं, ऐसे में उनका सुसाइड करना मुमकिन नहीं है। उस समय मुझे ये विश्वास दिलाया गया कि मेरी बेटी की मौत एक हादसा थी। पूर्व महापौर किशोरी पेडणेकर, मालवणी पुलिस थाने के अधिकारी लगातार इस बात पर जोर दे रहे थे कि वे जो बात कह रहे हैं, वो सच है। इन्हीं लोगों ने मेरे परिवार को लगातार दबाव में रखा और नजरबंद किया था। हमारी हर एक्टिविटी पर उनकी नजर थी।

8 जून की पार्टी में आदित्य ठाकरे भी थे शामिल?
याचिका में ये भी कहा गया है कि मुंबई पुलिस ने दिशा के गैंगरेप और मर्डर को दबाने की कोशिश की। इसके लिए पुलिस ने सभी गवाह, फोरेंसिक रिपोर्ट, पोस्टमॉर्टम रिपोर्ट जैसी सारी चीजें फर्जी तरीके से तैयार कीं। चश्मदीदों के मुताबिकर 8 जून 2020 की रात दिशा के मालवणी वाले घर पर एक पार्टी थी जिसमें उसके कुछ करीबी दोस्त शामिल हुए थे। इस दौरान आदित्य ठाकरे, एक्टर सूरज पंचोली और डिनो मोरिया भी दिशा के घर पहुंचे थे। इस घटना के बाद ही दिशा को मौत के घाट उतार दिया गया।

नितेश राणे ने लगाया बड़ा आरोप
इधर, बीजेपी विधायक नितेश राणे ने दावा किया कि दिशा सालियान मामले को लेकर उद्धव ठाकरे ने उनके पिता नारायण राणे को दो बार फोन कर मदद की गुहार लगाई थी। नितेश राणे ने कहा, उद्धव ठाकरे ने नारायण राणे से कहा था कि तुम्हारे भी दो बच्चे हैं, मेरे भी दो बच्चे हैं। अगर आदित्य ठाकरे निर्दोष हैं, तो उन्हें कैमरे के सामने आकर यह कहना चाहिए कि 8 जून 2020 को वे कहां थे।
राणे ने यह भी दावा किया कि दिशा सालियान के पिता के अनुसार इस मामले में तीन मास्टरमाइंड हैं - आदित्य ठाकरे, सूरज पंचोली और डिनो मोर्या। उन्होंने कहा, अब मैं यह आरोप नहीं लगा रहा, बल्कि दिशा सालियान के पिता खुद यह आरोप लगा रहे हैं।

पाकिस्तान से क्यों अलग होना चाहते हैं बलूच? आजादी की लड़ाई नाजुक मोड़ पर
#whybaluchistananxioustobefreefrom_pakistan 
बलूचिस्तान में जाफर एक्सप्रेस ट्रेन हाईजैकिंग कांड ने बलूचियों और पाकिस्तानियों के बीच के पुराने संघर्ष को उजागर कर दिया है। अपने खोए अस्‍तित्‍व वापस पाने के लिए बलूचिस्‍तान लिब्रेशन आर्मी (बीएलए) ने एक बार फिर पाकिस्‍तानी सेना के खिलाफ बिगुल फूंक दिया है। बलूचों ने ठान लिया है कि वो आजादी हासिल करके रहेंगे। जबरन पाकिस्‍तान मिलाने का दर्द उस वक्‍त बलूचियों के लिए नासूर बना गया, जब पाकिस्‍तान ने उनकी प्राकृतिक संपदा का दोहन शुरू कर दिया।

पाकिस्तान का सबसे संपन्न लेकिन पिछड़ा राज्य
बलूचिस्तान, पाकिस्तान का सबसे बड़ा राज्य है और 44 फीसदी हिस्सा कवर करता है। जर्मनी के आकार का होने का बावजूद यहां की आबादी सिर्फ डेढ़ करोड़ है, जर्मनी से 7 करोड़ कम। बलूचिस्तान तेल, सोना, तांबा और अन्य खदानों से सम्पन्न है। इन संसाधनों का इस्तेमाल कर पाकिस्तान अपनी जरूरतें पूरी करता है। इसके बाद भी ये इलाका सबसे पिछड़ा है। यही वजह है कि बलूचिस्तान में पाकिस्तान के खिलाफ नफरत बढ़ रही है। 

आधुनिक बलूचिस्तान की कहानी
बलूचिस्तान कभी भी पाकिस्तान का अंग नहीं बनना चाहता था। जबरन पाकिस्‍तान मिलाने का दर्द बलूचियों के लिए नासूर बना गया है। अब बलूचों की आजादी की लड़ाई नाजुक मोड़ पर पहुंच गई है। आधुनिक बलूचिस्तान की कहानी 1876 से शुरू होती है। तब बलूचिस्तान पर कलात रियासत का शासन था। भारतीय उपमहाद्वीप पर ब्रिटिश हुकूमत शासन कर रही थी। इसी साल ब्रिटिश सरकार और कलात के बीच संधि हुई।
संधि के मुताबिक अंग्रेजों ने कलात को सिक्किम और भूटान की तरह प्रोटेक्टोरेट स्टेट का दर्जा दिया। यानी भूटान और सिक्किम की तरह कलात के आंतरिक मामलों में ब्रिटिश सरकार का दखल नहीं था, लेकिन विदेश और रक्षा मामलों पर उसका नियंत्रण था

भारत-पाक की तरह कलात में भी आजादी की मांग
1947 में भारतीय उपमहाद्वीप में आजादी की प्रक्रिया की शुरुआत हुई। भारत और पाकिस्तान की तरह कलात में भी आजादी की मांग तेज हो गई। जब 1946 में ये तय हो गया कि अंग्रेज भारत छोड़ रहे हैं, तब कलात के खान यानी शासक मीर अहमद खान ने अंग्रेजों के सामने अपना पक्ष रखने के लिए मोहम्मद अली जिन्ना को सरकारी वकील बनाया। बलूचिस्तान नाम से एक नया देश बनाने के लिए 4 अगस्त 1947 को दिल्ली में एक बैठक बुलाई गई। इसमें मीर अहमद खान के साथ जिन्ना और जवाहर लाल नेहरू भी शामिल हुए। बैठक में जिन्ना ने कलात की आजादी की वकालत की।
बैठक में ब्रिटिश वायसराय लॉर्ड माउंटबेटन ने भी माना कि कलात को भारत या पाकिस्तान का हिस्सा बनने की जरूरत नहीं है। तब जिन्ना ने ही ये सुझाव दिया कि चार जिलों- कलात, खरान, लास बेला और मकरान को मिलाकर एक आजाद बलूचिस्तान बनाया जाए

आजादी की घोषणा के एक महीने बाद बदले हालात
11 अगस्त 1947 को कलात और मुस्लिम लीग के बीच एक समझौते पर हस्ताक्षर हुए। इसके साथ ही बलूचिस्तान एक अलग देश बन गया। हालांकि, इसमें एक पेंच ये था कि बलूचिस्तान की सुरक्षा पाकिस्तान के हवाले थी। आखिरकार कलात के खान ने 12 अगस्त को बलूचिस्तान को एक आजाद देश घोषित कर दिया। बलूचिस्तान में मस्जिद से कलात का पारंपरिक झंडा फहराया गया। कलात के शासक मीर अहमद खान के नाम पर खुतबा पढ़ा गया।
लेकिन, आजादी घोषित करने के ठीक एक महीने बाद 12 सितंबर को ब्रिटेन ने एक प्रस्ताव पारित किया और कहा कि बलूचिस्तान एक अलग देश बनने की हालत में नहीं है। वह अंतरराष्ट्रीय जिम्मेदारियां नहीं उठा सकता।

बलूचिस्तान जबरन पाकिस्‍तान में मिला दिया
कलात के खान ने अक्टूबर 1947 में पाकिस्तान का दौरा किया। उन्हें उम्मीद थी कि जिन्ना उनकी मदद करेंगे। जब खान कराची पहुंचे तो वहां मौजूद हजारों बलूच लोगों ने उनका स्वागत बलूचिस्तान के राजा की तरह किया, लेकिन उनका स्वागत करने पाकिस्तान का कोई बड़ा अधिकारी नहीं पहुंचा।पाकिस्तान के इरादे में बदलाव का यह बड़ा संकेत था। बलूचिस्तान जबरन पाकिस्‍तान में मिला दिया गया। इसी के साथ पाकिस्‍तान ने उनकी प्राकृतिक संपदा का दोहन शुरू कर दिया। बदले में बलूचिस्‍तान को ना ही विकास मिला और ना ही उनके प्राकृतिक संपदा के दोहन से होने वाले फायदे में कोई हिस्‍सा। देखते ही देखते, बलूचिस्‍तान की प्राकृतिक संपदा पाकिस्‍तान की अर्थव्‍यवस्‍था की रीढ़ बन चुकी थी, लेकिन बलूचिस्‍तान कंगाली की गर्त में जा गिरा था। 

1948 से जारी है विद्रोह
बलूचिस्‍तान की जनसंख्या का एक बड़ा हिस्सा शुरू से ही स्वतंत्रता और स्वायत्तता की मांग करता रहा है। उन्होंने 1948 में पाकिस्तान के खिलाफ पहला विद्रोह शुरू किया। पाकिस्तान ने 1948 के विद्रोह को कुचल दिया। विद्रोह को तब भले ही दबा दिया गया, लेकिन ये कभी खत्म नहीं हुआ। बलूचिस्तान की आजादी के लिए शुरू हुए इस विद्रोह को नए नेता मिलते रहे। 1950, 1960 और 1970 के दशक में वे पाकिस्तान सरकार के लिए चुनौती बनते रहे। 2000 तक पाकिस्तान के खिलाफ चार बलूच विद्रोह हुए।

Dignexus: Your One-Stop Shop in Kolkata for Mobile App Development, Website Design, and Digital Marketing
 
Dignexus, a reputed company that excels in Data-Driven Digital Marketing, Custom Software Development, and Mobile App Development, is proud to commemorate ten years of success in the IT industry. They are one of the pioneers in IT consulting and development services and can boast of their ground-breaking solutions that enhance the growth of their clients and help them stay ahead of their competitors. 
The Vision Behind The Success So Far
Dignexus commenced its successful journey 10 years ago with a dream and vision to empower businesses with data-driven strategies and cutting-edge technology. So far they have worked with numerous companies from different niches and have been a part of their clients’ success stories.
The vast sphere of companies in which they have excelled includes healthcare, e-commerce, banking, education, automotive, travel, and both B2B and B2C sectors.
Empowering Clients for Success 
Dignexus' main focus and priority is to empower the clients and make their vision into a reality. The motto they abide by is helping the clients "win in their domain." That vision has always been the driving force behind the excellent teamwork of Dignexus. The skilled team is always eager to walk the extra mile to deliver more than expected. 
Dignexus’s industry-leading solutions and innovative approach are what make them stand apart from other companies. From designing engaging and efficient mobile applications to developing custom software tailored to specific business requirements, Dignexus makes sure its clients stay ahead in the cutthroat market of today.
Why Dignexus Is the Best Choice
Data-Driven Marketing
As the best Digital Marketing Agency in Kolkata, we can efficiently leverage the true power of analytics to create data-based campaigns that maximize ROI.
Custom Solutions: 
We do not believe in taking shortcuts just to deliver a sub-par project. Our team knows how to develop and deliver bespoke solutions, be it software or mobile apps tailored to our client’s unique needs.
Award-Winning Design: 
We have already earned our name and have been recognized as the best Website Design Company in Kolkata. We are known for creating visually stunning and user-friendly websites that enhance brand presence.
Proven Track Record
We have successfully completed a decade as one of the best solution-driven companies with a large number of clients applauding us.  
A Decade of Accomplishments
From empowering startups to simplifying operations for large corporations, Dignexus has been essential in helping companies succeed in their domains. The diverse industries represented in our portfolio demonstrate our capacity to adapt to the different needs of different clients. 
Looking Ahead
Dignexus is committed and ready to keep adding new feathers by setting new benchmarks in IT services. We believe in our unwavering focus on innovation and aim to drive digital transformation to the growth of businesses worldwide.
For more information about our services, feel free to:
Visit www.dignexus.com 
Contact us at Dignexus
Dignexus is a Kolkata-based IT consulting and development company specializing in Mobile App Development, Custom Software Development, and Data-Driven Digital Marketing. With 10 years of industry experience and an excellent team of skilled and dedicated professionals, Dignexus is focused on evolving to keep delivering world-class IT solutions that empower businesses to achieve their business goals.
_____________________

 

Alt Beauty Is Changing the Way India Does Skincare, One Smart Product at a Time
If you’ve ever stood in front of your mirror, wondering why your skincare routine takes longer than your actual breakfast, you’re not alone. Most of us are tired of long 10-step routines, layering serum over serum, and still not seeing the glow we were promised. Skincare has somehow become more stressful than soothing. But now, a new Indian brand is here to change that—say hello to altBeauty.
Alt Beauty isn’t just another skincare label. It was created by someone who knows skin inside out. Dr. Pallavi Ahire-Shelke, an award-winning dermatologist, saw how her busy clients were constantly overwhelmed by confusing ingredients and product overload. That’s why she decided to flip the script. Her idea was simple: why not make skincare smart and simple, not complicated?
What makes Alt Beauty different is how practical and science-backed it is. These are multi-tasking products designed to save you time without cutting corners. Every formula is packed with dermatologist-approved ingredients, safe for Indian skin and the daily lifestyle challenges we all face—like sun, stress, screen-time and pollution.
Let’s talk about the product that’s winning hearts already: the Smart Sunscreen. It’s not your average SPF. This one is completely mineral-based, so it’s gentle and non-toxic. It’s packed with SPF 60 and protects not just against UV rays, but also blue light from screens, IR radiations and harmful pollution. It also has niacinamide, vitamin C and hyaluronic acid built in, so you don’t need a separate moisturizer. Basically, it replaces your sunscreen, moisturizer, antioxidant serum and makeup base—all in one tube. It’s even safe for pregnant women. No white cast, no greasiness, complete daytime skin protection.
Then there’s the Smart Night Gel—a power-packed overnight repair cream that does the work while you sleep. It’s got plant-based retinol, glutathione, peptides, ceramides, AHA-BHA, and more to fight signs of aging, boost hydration, and leave your skin brighter by morning. And if you’re starting your routine, the Clean-n-Tone Cleanser is a game changer. It cleanses, tones and removes makeup in one step. You can even use it without water. Super handy on the go usage.
Alt Beauty products aren’t just multi-purpose—they’re made to be kind to your skin and kind to your time. That’s why more than 1,000 people tried the brand in its very first month. And many of them are already coming back for more. Real customers are saying they’ve finally found skincare that actually fits into their lives—and works.
What’s even more refreshing is the brand’s belief that beauty starts from within. Alt Beauty doesn’t sell filters or perfection. It’s about helping you feel confident, creative and comfortable in your skin. They have a vibrant community which guides skin health with focusing on lifestyle, nutrition, mind and soul and art forms related guidance which could help everyone. Whether you’re someone who’s just starting out or someone who’s tried every product under the sun, Alt Beauty is here to simplify the way you care for your skin.
If you’re tired of spending too much time and money on too many skincare products, this might just be the solution you’ve been waiting for. Smart, efficient, and designed for modern Indian lifestyles—Alt Beauty is the skincare shortcut your busy life needs.
Check it out for yourself at Website and Instagram

Alt Beauty Is Changing the Way India Does Skincare, One Smart Product at a Time
If you’ve ever stood in front of your mirror, wondering why your skincare routine takes longer than your actual breakfast, you’re not alone. Most of us are tired of long 10-step routines, layering serum over serum, and still not seeing the glow we were promised. Skincare has somehow become more stressful than soothing. But now, a new Indian brand is here to change that—say hello to altBeauty.
Alt Beauty isn’t just another skincare label. It was created by someone who knows skin inside out. Dr. Pallavi Ahire-Shelke, an award-winning dermatologist, saw how her busy clients were constantly overwhelmed by confusing ingredients and product overload. That’s why she decided to flip the script. Her idea was simple: why not make skincare smart and simple, not complicated?
What makes Alt Beauty different is how practical and science-backed it is. These are multi-tasking products designed to save you time without cutting corners. Every formula is packed with dermatologist-approved ingredients, safe for Indian skin and the daily lifestyle challenges we all face—like sun, stress, screen-time and pollution.
Let’s talk about the product that’s winning hearts already: the Smart Sunscreen. It’s not your average SPF. This one is completely mineral-based, so it’s gentle and non-toxic. It’s packed with SPF 60 and protects not just against UV rays, but also blue light from screens, IR radiations and harmful pollution. It also has niacinamide, vitamin C and hyaluronic acid built in, so you don’t need a separate moisturizer. Basically, it replaces your sunscreen, moisturizer, antioxidant serum and makeup base—all in one tube. It’s even safe for pregnant women. No white cast, no greasiness, complete daytime skin protection.
Then there’s the Smart Night Gel—a power-packed overnight repair cream that does the work while you sleep. It’s got plant-based retinol, glutathione, peptides, ceramides, AHA-BHA, and more to fight signs of aging, boost hydration, and leave your skin brighter by morning. And if you’re starting your routine, the Clean-n-Tone Cleanser is a game changer. It cleanses, tones and removes makeup in one step. You can even use it without water. Super handy on the go usage.
Alt Beauty products aren’t just multi-purpose—they’re made to be kind to your skin and kind to your time. That’s why more than 1,000 people tried the brand in its very first month. And many of them are already coming back for more. Real customers are saying they’ve finally found skincare that actually fits into their lives—and works.
What’s even more refreshing is the brand’s belief that beauty starts from within. Alt Beauty doesn’t sell filters or perfection. It’s about helping you feel confident, creative and comfortable in your skin. They have a vibrant community which guides skin health with focusing on lifestyle, nutrition, mind and soul and art forms related guidance which could help everyone. Whether you’re someone who’s just starting out or someone who’s tried every product under the sun, Alt Beauty is here to simplify the way you care for your skin.
If you’re tired of spending too much time and money on too many skincare products, this might just be the solution you’ve been waiting for. Smart, efficient, and designed for modern Indian lifestyles—Alt Beauty is the skincare shortcut your busy life needs.
Check it out for yourself at Website and Instagram

दरोगा विद्यासागर के अपराध,काली कमाई ने बेटे को बना दिया अपराधी


  


जौनपुर। बहुत पुरानी कहावत है "कि बाप का खाया बेटा भरता हैं" लेकिन यह कहावत बिल्कुल फिट बैठ रही हैं. थानागद्दी चौकी पर तैनात प्रमोटी दारोगा विद्यासागर सिंह के बेटे आदित्य सागर के खिलाफ पड़ोसी वाराणसी जिले के चोलापुर थाने में गंभीर धाराओं में आरोपी बनाया हैं।

जानकारी के मुताबिक विद्यासागर सिंह सिपाही से प्रोन्नत होकर दरोगा बने। अल्प समय के लिए दरोगा की कुर्सी व कंधे पर सितारे लगते ही शरीर में ऐंठन होने लगी। फिर खाकी में अपराध व अवैध कामों को संरक्षण देकर के धन बटोरने में जुट गया। विभागीय लोग बताते हैं कि विद्यासागर के बेटे बेरोजगार हैं। जिससे विद्यासागर को हरवक्त बेटे को सजोने संवारने में जुट रहता हैं। जिसके लिए हरसंभव प्रयास करके अपराध में धंसता गया। खुद का सिंडिकेट तैयार लिया। जिसमें कुछ तथाकथित पत्रकारों को भी शामिल किया। जिससे किसी भी घटना को दबाते हुए,वसूली को प्रायोजित तरीके से कराई जा सके।

विद्यासागर ने अपराध से अर्जित काली कमाई से एक कृषि कार्य में रजिस्टर्ड ट्रैक्टर UP62AS9996 लिया। जिससे कमर्शियल उपयोग में लेने लगा। ट्रैक्टर को अपराधिक सिंडिकेट के इशारे पर अवैध कामों में धकेल दिया। अवैध व अपराध से अर्जित राशि ने ज्यादा दिन तक विद्यासागर का साथ नहीं दिया। कुछ माह बाद चोलापुर पुलिस ने हिट एंड रन का मामला आदित्य सागर के खिलाफ दर्ज करते हुए,चार्जशीट न्यायालय में भेज दिया।

कप्तान ने कतरे पर,भेजा खेतासराय
अपराध में धंसते जा रहे विद्यासागर को स्थानीय अधिकारियों का प्रश्रय था. जिससे विद्यासागर आराम से अपने कामों को अंजाम दे रहा था। लगातार शिकायतों को देखते हुए,कप्तान ने विद्यासागर का ट्रांसफर खेतासराय कर दिया। ट्रांसफर की बात सुनकर विद्यासागर के होश उड़ गए। अपराधिक सिंडिकेट के साथ विद्यासागर ने कई चौखटों पर माथा टेकते हुए,ट्रांसफर रुकवाने की गुहार की। लेकिन किसी ने नहीं सुनी। चूंकि खेतासराय में अवैध कमाई बंद हो चुकी हैं। सिंडिकेट भी बिखर चुका हैं। विभाग के अनुसार विद्यासागर केराकत थाना क्षेत्र के सरकी चौकी पर आने के लिए हर संभव प्रयास कर रहा हैं। जिससे सिंडिकेट व अपराधिक गतिविधि से काली कमाई की जा सके।

Dr. Ankit Agrawal and i2CAN Skin Care Clinic: A Trusted Name in Dermatology in Delhi and Mathura


New Delhi / Mathura: When it comes to skin and hair care, people today are looking for experts they can truly trust. That’s where Dr. Ankit Agrawal, a renowned dermatologist and cosmetologist, steps in with his advanced and patient-friendly approach. Heading the i2CAN Skin Care Clinic, Dr. Agrawal has become a well-known name in both Delhi and Mathura, offering top-quality skincare services to thousands of satisfied patients. The i2CAN Skin Care Clinic, located at 1st Floor, Near Shalimar Palace, Kaushik Enclave, Burari, New Delhi, serves as a hub for advanced skincare solutions. The clinic has also extended its presence to Mathura, allowing more people to benefit from expert consultation and cutting-edge treatments. Strategically located in these two cities, i2CAN is becoming the preferred choice for people seeking reliable and result-oriented dermatological care.



Under the leadership of Dr. Agrawal, i2CAN Skin Care Clinic has grown into a top-notch institute, offering a comprehensive range of skin and hair treatments. The clinic blends medical excellence with advanced technologies, ensuring that patients receive modern, effective, and personalized care. Whether the concern is acne, pigmentation, hair fall, skin allergies, or aesthetic enhancements like PRP therapy, laser hair reduction, or anti-aging procedures, patients can expect solutions tailored to their individual needs.





Dr. Ankit Agrawal is known for his hands-on approach, attention to detail, and deep understanding of dermatological conditions. He is appreciated not just for his professional knowledge but also for his genuine care and honest advice. Patients across Delhi and Mathura often speak highly of his clear communication style, gentle manner, and dedication to achieving visible, long-lasting results. He also emphasizes educating patients about their skin type, condition, and how to maintain healthy skin beyond the clinic.





What sets i2CAN Skin Care Clinic apart is its well-rounded team. The clinic is home to trained professionals who assist Dr. Agrawal in delivering high-quality services with consistency and compassion. Every member of the team is committed to maintaining the clinic’s standards of hygiene, patient comfort, and timely service. This combination of expertise and hospitality is a big reason why i2CAN has grown rapidly in popularity and trust.





In terms of infrastructure, the clinic features a modern, welcoming environment equipped with the latest diagnostic and therapeutic tools. The clinic also adheres strictly to safety protocols and international standards, making it a safe and comfortable space for both first-time and regular visitors. From the moment a patient steps in until the completion of their treatment, they are guided and supported at every step.





The clinic’s growing patient base is also a result of its transparent pricing and flexible treatment plans. By keeping services affordable without compromising on quality, i2CAN Skin Care Clinic makes professional dermatological care accessible to a wider community. This approach is particularly appreciated in areas like Burari and Mathura, where high-end skincare services were previously limited.





Dr. Agrawal has long-term plans to expand the clinic’s services across Delhi NCR and parts of Uttar Pradesh, reaching more people who deserve top-quality skincare. His mission is simple—to make people feel confident and comfortable in their own skin. With his knowledge, experience, and a great team behind him, he is well on his way to achieving it.
https://www.instagram.com/iicandelhi/
https://mathura.iicanpune.in/

If you’re searching for a dermatologist you can trust, i2CAN Skin Care Clinic offers everything you need—experience, technology, compassion, and consistent results. Whether you live in North Delhi, Kaushik Enclave, or Mathura, Dr. Ankit Agrawal’s clinic is just around the corner, ready to help you look and feel your best.

  *Fortress vs Flair as Mohun Bagan Super Giant lock horns with Bengaluru FC in a blockbuster title clash*
Sports 

 ISL 
 


 Kolkata : Mohun Bagan Super Giant (MBSG) will face Bengaluru FC in the final of the Indian Super League (ISL) 2024-25 at the Vivekananda Yuba Bharati Krirangan (VYBK) on April 12, at 7:30 PM IST in a blockbuster winner takes all clash befitting of a much awaited title clash.

Speaking at the pre-match press conference in Kolkata ahead of the final, Mohun Bagan Super Giant Head Coach Jose Molina stressed on the importance of looking forward and not worrying about the past. “I don’t care about what happened in the past. I am trying to do my best for Mohun Bagan Super Giant. We did well to win the League Shield and we are motivated to win the ISL Cup too. I don’t need extra motivation from the fact that we lost the final last year. We are already motivated enough.”

Bengaluru FC Head Coach Gerard Zaragoza, who showed exemplary camaraderie by helping a translate a question for his counterpart Molina, was chuffed about playing the big final in Kolkata. “We are very motivated for the finals and excited for the game. Everything is fine. We are confident and Kolkata is almost like our second home, because we were here for the Durand Cup. We had a good playoffs and we are looking forward to the grand finale.”

His sentiment was echoed by BFC goalkeeper Gurpreet Singh Sandhu, who spoke fondly about his long association with the city. “As you know, my journey as a professional footballer started here and I was very lucky to be getting opportunities to play matches from the beginning. I am grateful for the journey. If you get an opportunity to play big games, big finals, in front of big crowds as a player, it’s a great experience and I am lucky to be here for the match in Kolkata.” Gurpreet also reserved some special praise for the opponents, saying, “Mohun Bagan Super Giant have been the standout team this season and there is no denying that, which is why they won the League Shield.”

Mohun Bagan Super Giant captain Subhasish Bose, who Molina jokingly referred to as a striker in light of his goalscoring form in this edition, shed light on the significance of the venue as a local boy. “I am always thrilled to play in front of our home fans. I wish that the fans support us wholeheartedly against Bengaluru FC tomorrow.”

MBSG are the League Shield Winners, whereas Bengaluru FC finished third in the standings and then cruised past the challenges that fronted them in the eliminator and semi-final to make it to the summit clash.

It is a fourth ISL finals appearance for BFC in just 8 seasons, while MBSG have become the first team to reach this stage three successive times. This fixture is an encore of the ISL 2022-23 showdown, when both these sides had clashed in the season finale, with the Kolkata-based team emerging triumphant via penalties in a very tight contest.

They have the chance to repeat that feat in front of a vociferous home crowd this time around, whereas Bengaluru FC will take confidence from their recent form to distort MBSG’s record of staying unbeaten at home thus far in the current campaign.
 Pic : Sanjay Hazra (khabar kolkata).

अमेरिका में क्यों कैंसिल हो रहा स्टूडेंट वीजा? भारत के 3 लाख स्टूडेंट्स की बढ़ी परेशानी
#whyusstudentvisacancelled


टैरिफ वॉर के बीच अमेरिका में अब विदेशी छात्रों की परेशानी बढ़ गई है। ट्रंप की सरकार में इमिग्रेशन नीतियों को कड़ा किया गया है। सैकड़ों छात्रों को स्टूडेंट वीजा रद्द कर उन्हें डिपोर्ट किया गया है। अमेरिका में पढ़ने वाले भारतीय छात्रों पर भी एक्शन लिया गाय है। मौजूदा सरकार की नीतियों की वजह विदेशी छात्रों और यूनिवर्सिटीज दोनों की परेशानी बढ़ गई है। 

अमेरिका में पढ़ाई कर रहे छात्रों के F-1 वीजा को मामूली अपराधों के आधार पर रद्द करना शुरू कर दिया है। इनमें ट्रैफिक नियमों का उल्लंघन, डिंक एंड ड्राइव, ओवर स्पीडिंग और शॉप-लिफ्टिंग जैसे अपराध शामिल हैं। सिर्फ इतना ही नहीं, बल्कि फिलिस्तीन समर्थक बयानबाजी, विरोध-प्रदर्शन और सोशल मीडिया पर पोस्टिंग को लेकर भी वीजा कैंसिल हुए हैं। अधिकारी आव्रजन और राष्ट्रीयता अधिनियम के तहत शायद ही कभी इस्तेमाल की जाने वाली शक्तियों का इस्तेमाल कर रहे हैं। इससे छात्र अनिश्चितता में हैं।

वीजा कैंसिल होने से स्टूडेंट परेशान
अमेरिकी राष्ट्रपति ट्रंप की वजह से दुनिया में नया टैरिफ वॉर छिड़ गया है। इससे सभी देश पहले ही परेशान हैं। अब ट्रंप सरकार ने जिस तरह से छात्रों के खिलाफ रुख अपनाया है उसने एक नई समस्या को जन्म दे दिया है। अमेरिका ने दुनिया के कई छात्रों को अमेरिका छोड़ने की हिदायत दी है, इनमें भारतीय छात्र भी शामिल हैं। इनका वीजा रद्द कर दिया गया है और मेल भेजकर इन्हें इस बात की जानकारी भी दे दी गई है। इनसे कह दिया गया है कि वह खुद डिपोर्ट हो जाएं।
कई छात्रों ने दावा किया कि उनकी पुरानी गलतियों को आधार बना जा रहा है, जिनकी सभी कानूनी कार्रवाई पूरी हो चुकी हैं। एक छात्र ने बताया कि उसने 2 साल पहले स्पीडिंग का उल्लंघन किया था और जुर्माना भर दिया था। एक अन्य ने शराब पीकर गाड़ी चलाने के बाद सभी शर्तें पूरी की थीं।

वीजा पर नई नीति काफी सख्त
अमेरिका ने हाल ही में वीजा के लिए एक नया नियम बनाया था। अमेरिका में F-1 , M-1 और J-1 वीजा दिए जाते हैं, जिन्हें स्टूडेंट वीजा के तौर पर जाना जाता है। इस वीजा के जरिए स्टूडेंट्स अमेरिका के कॉलेजों और यूनिवर्सिटीज में पढ़ने जाते हैं। स्टूडेंट वीजा विदेश विभाग द्वारा जारी किया जाता है। छात्रों को फुल-टाइम स्टूडेंट के तौर पर पढ़ने के लिए वीजा मिलता है। वीजा मिलने के बाद उन्हें सख्त नियमों का पालन करना होता है। पहले किसी का वीजा रद्द होने पर भी उन्हें पढ़ने की इजाजत थी, लेकिन नई नीतियों के बाद अब उन्हें तुरंत देश छोड़ना होगा।

वीजा अप्लाई करने वालों के सोशल मीडिया अकाउंट पर नजर
यूएस सेक्रेटरी ऑफ स्टेट मार्को रुबियो ने खुद ये बताया था कि मार्च से अमेरिका में वीजा के लिए अप्लाई करने वालों का सोशल मीडिया अकाउंट भी खंगाला जाएगा। इसका उद्देश्य ये था कि जिन लोगों ने किसी भी तरह इजराइल या अमेरिका की सोशल मीडिया पर आलोचना की है उन्हें अमेरिका आने से रोका जा सके। इसके अलावा रूबियो ने अमेरिका में पढ़ रहे विदेशी छात्रों के सोशल मीडिया अकाउंट पर भी नजर रखने को कहा था। इसके बाद से अमेरिका में वीजा रद्द करने का काम तेजी पकड़ चुका है।

क्या है बिम्सटेक, जिसके समिट में शामिल होने बैंकॉक पहुंचे पीएम मोदी, भारत के लिए क्यों जरूरी
#whatisbimstecandwhyisitsignificantfor_india
प्रधानमंत्री नरेंद्र मोदी गुरुवार को थाईलैंड की राजधानी बैंकॉक पहुंचे। पीएम मोदी बंगाल इनिशिएटिव फॉर सेक्टोरल टेक्निकल एंड इकोनॉमिक कोऑपरेशन यानि बिम्सटेक के शिखर सम्मेलन में शामिल होंने बैंकॉक पहुंचे हैं।कल यह सम्मेलन होना है।वहीं, विदेश मंत्री एस जयशंकर पहले से ही बैंकॉक में हैं। उन्होंने आज 20वीं बिम्सटेक मंत्रिस्तरीय बैठक में भाग लिया। ऐसे में सवाल उठता है कि बिम्सटेक क्या है और यह भारत के लिए क्यों इतना जरूरी है कि पीएम मोदी और एस जयशंकर इस बैठक में हिस्सा लेने के लिए बैंकॉक पहुंचे हैं।

बिम्सटेक क्या है?
बिम्सटेक यानी बंगाल की खाड़ी बहु-क्षेत्रीय तकनीकी और आर्थिक सहयोग पहल है। यह एक क्षेत्रीय संगठन है जिसमें बंगाल की खाड़ी के आसपास स्थित सात सदस्य देश शामिल हैं। इस उप-क्षेत्रीय संगठन की स्थापना 6 जून 1997 को बैंकॉक घोषणा के माध्यम से की गई थी। सात सदस्य देशों में दक्षिण एशिया के पांच देश- बांग्लादेश, भूटान, भारत, नेपाल और श्रीलंका- और दक्षिण-पूर्व एशिया के दो देश- म्यांमार और थाईलैंड शामिल हैं। मूल रूप से, इस ब्लॉक की शुरुआत चार सदस्य देशों के साथ हुई थी, जिसका नाम 'BIST-EC' (बांग्लादेश, भारत, श्रीलंका और थाईलैंड आर्थिक सहयोग) था।

क्या है संगठन का मुख्य उद्देश्य?
संगठन का मुख्य उद्देश्य बंगाल की खाड़ी से जुड़े देशों की आर्थिक तरक्की, आपसी सहयोग, क्षेत्रीय चुनौतियों से मिलकर निपटने की नीति, आपसी हितों पर विचार-विमर्श करना आदि था। सहयोग और समानता की भावना पैदा करने के साथ ही शिक्षा, विज्ञान-तकनीक के क्षेत्र में एक-दूसरे की खुलकर मदद करना भी इसके उद्देश्यों में शामिल है। समान संप्रभुता, क्षेत्रीय अखंडता, राजनीतिक स्वतंत्रता, आंतरिक मामलों में हस्तक्षेप न करना, शांतिपूर्ण श-अस्तित्व, पारस्परिक लाभ, सदस्य देशों के बीच अन्य द्विपक्षीय, क्षेत्रीय एवं बहुपक्षीय सहयोग जैसे मुद्दे भी इस महत्वपूर्ण संगठन के प्रमुख सिद्धांतों में शामिल किये गए हैं।

दुनिया के लिए क्यों महत्वपूर्ण है बिम्सटेक?
दुनिया के लिए भी यह बेहद महत्वपूर्ण है। मीडिया रिपोर्ट की मानें तो दुनिया की कुल आबादी का 22 फीसदी से ज्यादा हिस्सा इन्हीं सात देशों में निवास करता है। दुनिया के कुल व्यापार का एक चौथाई से ज्यादा हिस्सा बंगाल की खाड़ी से होकर गुजरता है। सदस्य देशों की संयुक्त जीडीपी लगभग 4 ट्रिलियन अमेरिकी डॉलर बताई जाती है।ये आंकड़े यह बताने को काफी हैं कि दुनिया के लिए यह संगठन और इसके सदस्य देश कितने महत्वपूर्ण हैं। 
बिम्सटेक की पहल पर कुछ महत्वपूर्ण परियोजनाओं पर काम हुआ, जिसका सीधा लाभ सदस्य देशों को मिल रहा है। इनमें भारत और म्यांमार को जोड़ने वाली कलादान मल्टी मॉडल परियोजना, म्यांमार से होकर भारत और थाईलैंड को जोड़ने वाली एशियाई त्रिपक्षीय राजमार्ग तथा यात्री एवं माल परिवहन के सुगम प्रवाह हेतु बांग्लादेश-भारत-भूटान-नेपाल मोटर वाहन समझौता शामिल है।

दिशा सालियान मौत मामले में क्यों आ रहा आदित्य ठाकरे का नाम? महाराष्ट्र में नया सियासत बवाल
#dishasaliandeathcaseadityathackeraynamewhyinvolved
दिशा सालियान मर्डर केस एक बार फिर सुर्खियों में है। 8 जून 2020 को दिशा की मौत हुई। इसके 6 दिन एक्टर सुशांत सिंह राजपूत की लाश उनके कमरे में मिली। दिशा सुशांत की मैनेजर रह चुकी थी। दिशा की मौत का केस इस बार सुर्खियों में इसलिए आया, क्योंकि उसके पिता सतीश ने बेटी की मौत की नए एंगल से जांच करने की मांग की है। हालांकि 5 साल पहले सतीश ने दिशा की मौत को सुसाइड मान लिया था, लेकिन अब उनका कहना है कि उन्हें सुसाइड मानने के लिए मजबूर किया गया था।

दिशा के पिता सतीश सालियान ने अपनी बेटी की मौत की नए सिरे से जांच की मांग करते हुए बॉम्बे हाईकोर्ट का रुख किया है और आदित्य ठाकरे के खिलाफ एफआईआर दर्ज करने की मांग की है। उन्होंने याचिका में दिशा सालियान के अंतिम संस्कार की तस्वीरों को भी अदालत में अपनी याचिका के साथ अटैच किया है। इस याचिका में वकील का कहना है कि जब दिशा का पार्थिव शरीर उसके परिवार को सौंपा गया, तब उसके शरीर पर किसी भी चोट या घाव के निशान नहीं थे, जबकि मालवणी पुलिस ने दावा किया था कि दिशा की मौत के समय उसका शरीर खून से लथपथ था।

दिशा की मौत मामले में आदित्य ठाकरे का नाम आ रहा है।सतीश सालियान ने कोर्ट में याचिका दायर कर आदित्य ठाकरे समेत कई लोगों पर गंभीर आरोप लगाए हैं। आदित्य ठाकरे और पूर्व मेयर किशोरी पेडनेकर के खिलाफ मामला दर्ज करने की मांग की गई है। दिशा सालियान के पिता ने बेटी की हत्या का दावा करते हुए आदित्य ठाकरे, एक्टर सूरज पंचोली और डिनो मोर्या पर गंभीर आरोप लगाए हैं। उन्होंने ये भी कहा है कि मुंबई पुलिस ने हकीकत को छुपाने की कोशिश की है। सतीश सालियान ने आदित्य ठाकरे पर ये भी आरोप लगाया है कि सुशांत सिंह राजपूत की मौत के बाद उन्होंने रिया चक्रवर्ती से 44 बार फोन पर फोन किया था।

परिवार को नजरबंद रखने का आरोप
सतीश सालियान ने याचिका में कहा है कि दिशा की मौत अचानक नहीं हुई। पहले उनके साथ गैंगरेप हुआ और फिर उनका मर्डर कर दिया गया। सतीश ने कहा-'दिशा अपने करियर को लेकर काफी सीरियस थीं, ऐसे में उनका सुसाइड करना मुमकिन नहीं है। उस समय मुझे ये विश्वास दिलाया गया कि मेरी बेटी की मौत एक हादसा थी। पूर्व महापौर किशोरी पेडणेकर, मालवणी पुलिस थाने के अधिकारी लगातार इस बात पर जोर दे रहे थे कि वे जो बात कह रहे हैं, वो सच है। इन्हीं लोगों ने मेरे परिवार को लगातार दबाव में रखा और नजरबंद किया था। हमारी हर एक्टिविटी पर उनकी नजर थी।

8 जून की पार्टी में आदित्य ठाकरे भी थे शामिल?
याचिका में ये भी कहा गया है कि मुंबई पुलिस ने दिशा के गैंगरेप और मर्डर को दबाने की कोशिश की। इसके लिए पुलिस ने सभी गवाह, फोरेंसिक रिपोर्ट, पोस्टमॉर्टम रिपोर्ट जैसी सारी चीजें फर्जी तरीके से तैयार कीं। चश्मदीदों के मुताबिकर 8 जून 2020 की रात दिशा के मालवणी वाले घर पर एक पार्टी थी जिसमें उसके कुछ करीबी दोस्त शामिल हुए थे। इस दौरान आदित्य ठाकरे, एक्टर सूरज पंचोली और डिनो मोरिया भी दिशा के घर पहुंचे थे। इस घटना के बाद ही दिशा को मौत के घाट उतार दिया गया।

नितेश राणे ने लगाया बड़ा आरोप
इधर, बीजेपी विधायक नितेश राणे ने दावा किया कि दिशा सालियान मामले को लेकर उद्धव ठाकरे ने उनके पिता नारायण राणे को दो बार फोन कर मदद की गुहार लगाई थी। नितेश राणे ने कहा, उद्धव ठाकरे ने नारायण राणे से कहा था कि तुम्हारे भी दो बच्चे हैं, मेरे भी दो बच्चे हैं। अगर आदित्य ठाकरे निर्दोष हैं, तो उन्हें कैमरे के सामने आकर यह कहना चाहिए कि 8 जून 2020 को वे कहां थे।
राणे ने यह भी दावा किया कि दिशा सालियान के पिता के अनुसार इस मामले में तीन मास्टरमाइंड हैं - आदित्य ठाकरे, सूरज पंचोली और डिनो मोर्या। उन्होंने कहा, अब मैं यह आरोप नहीं लगा रहा, बल्कि दिशा सालियान के पिता खुद यह आरोप लगा रहे हैं।

पाकिस्तान से क्यों अलग होना चाहते हैं बलूच? आजादी की लड़ाई नाजुक मोड़ पर
#whybaluchistananxioustobefreefrom_pakistan 
बलूचिस्तान में जाफर एक्सप्रेस ट्रेन हाईजैकिंग कांड ने बलूचियों और पाकिस्तानियों के बीच के पुराने संघर्ष को उजागर कर दिया है। अपने खोए अस्‍तित्‍व वापस पाने के लिए बलूचिस्‍तान लिब्रेशन आर्मी (बीएलए) ने एक बार फिर पाकिस्‍तानी सेना के खिलाफ बिगुल फूंक दिया है। बलूचों ने ठान लिया है कि वो आजादी हासिल करके रहेंगे। जबरन पाकिस्‍तान मिलाने का दर्द उस वक्‍त बलूचियों के लिए नासूर बना गया, जब पाकिस्‍तान ने उनकी प्राकृतिक संपदा का दोहन शुरू कर दिया।

पाकिस्तान का सबसे संपन्न लेकिन पिछड़ा राज्य
बलूचिस्तान, पाकिस्तान का सबसे बड़ा राज्य है और 44 फीसदी हिस्सा कवर करता है। जर्मनी के आकार का होने का बावजूद यहां की आबादी सिर्फ डेढ़ करोड़ है, जर्मनी से 7 करोड़ कम। बलूचिस्तान तेल, सोना, तांबा और अन्य खदानों से सम्पन्न है। इन संसाधनों का इस्तेमाल कर पाकिस्तान अपनी जरूरतें पूरी करता है। इसके बाद भी ये इलाका सबसे पिछड़ा है। यही वजह है कि बलूचिस्तान में पाकिस्तान के खिलाफ नफरत बढ़ रही है। 

आधुनिक बलूचिस्तान की कहानी
बलूचिस्तान कभी भी पाकिस्तान का अंग नहीं बनना चाहता था। जबरन पाकिस्‍तान मिलाने का दर्द बलूचियों के लिए नासूर बना गया है। अब बलूचों की आजादी की लड़ाई नाजुक मोड़ पर पहुंच गई है। आधुनिक बलूचिस्तान की कहानी 1876 से शुरू होती है। तब बलूचिस्तान पर कलात रियासत का शासन था। भारतीय उपमहाद्वीप पर ब्रिटिश हुकूमत शासन कर रही थी। इसी साल ब्रिटिश सरकार और कलात के बीच संधि हुई।
संधि के मुताबिक अंग्रेजों ने कलात को सिक्किम और भूटान की तरह प्रोटेक्टोरेट स्टेट का दर्जा दिया। यानी भूटान और सिक्किम की तरह कलात के आंतरिक मामलों में ब्रिटिश सरकार का दखल नहीं था, लेकिन विदेश और रक्षा मामलों पर उसका नियंत्रण था

भारत-पाक की तरह कलात में भी आजादी की मांग
1947 में भारतीय उपमहाद्वीप में आजादी की प्रक्रिया की शुरुआत हुई। भारत और पाकिस्तान की तरह कलात में भी आजादी की मांग तेज हो गई। जब 1946 में ये तय हो गया कि अंग्रेज भारत छोड़ रहे हैं, तब कलात के खान यानी शासक मीर अहमद खान ने अंग्रेजों के सामने अपना पक्ष रखने के लिए मोहम्मद अली जिन्ना को सरकारी वकील बनाया। बलूचिस्तान नाम से एक नया देश बनाने के लिए 4 अगस्त 1947 को दिल्ली में एक बैठक बुलाई गई। इसमें मीर अहमद खान के साथ जिन्ना और जवाहर लाल नेहरू भी शामिल हुए। बैठक में जिन्ना ने कलात की आजादी की वकालत की।
बैठक में ब्रिटिश वायसराय लॉर्ड माउंटबेटन ने भी माना कि कलात को भारत या पाकिस्तान का हिस्सा बनने की जरूरत नहीं है। तब जिन्ना ने ही ये सुझाव दिया कि चार जिलों- कलात, खरान, लास बेला और मकरान को मिलाकर एक आजाद बलूचिस्तान बनाया जाए

आजादी की घोषणा के एक महीने बाद बदले हालात
11 अगस्त 1947 को कलात और मुस्लिम लीग के बीच एक समझौते पर हस्ताक्षर हुए। इसके साथ ही बलूचिस्तान एक अलग देश बन गया। हालांकि, इसमें एक पेंच ये था कि बलूचिस्तान की सुरक्षा पाकिस्तान के हवाले थी। आखिरकार कलात के खान ने 12 अगस्त को बलूचिस्तान को एक आजाद देश घोषित कर दिया। बलूचिस्तान में मस्जिद से कलात का पारंपरिक झंडा फहराया गया। कलात के शासक मीर अहमद खान के नाम पर खुतबा पढ़ा गया।
लेकिन, आजादी घोषित करने के ठीक एक महीने बाद 12 सितंबर को ब्रिटेन ने एक प्रस्ताव पारित किया और कहा कि बलूचिस्तान एक अलग देश बनने की हालत में नहीं है। वह अंतरराष्ट्रीय जिम्मेदारियां नहीं उठा सकता।

बलूचिस्तान जबरन पाकिस्‍तान में मिला दिया
कलात के खान ने अक्टूबर 1947 में पाकिस्तान का दौरा किया। उन्हें उम्मीद थी कि जिन्ना उनकी मदद करेंगे। जब खान कराची पहुंचे तो वहां मौजूद हजारों बलूच लोगों ने उनका स्वागत बलूचिस्तान के राजा की तरह किया, लेकिन उनका स्वागत करने पाकिस्तान का कोई बड़ा अधिकारी नहीं पहुंचा।पाकिस्तान के इरादे में बदलाव का यह बड़ा संकेत था। बलूचिस्तान जबरन पाकिस्‍तान में मिला दिया गया। इसी के साथ पाकिस्‍तान ने उनकी प्राकृतिक संपदा का दोहन शुरू कर दिया। बदले में बलूचिस्‍तान को ना ही विकास मिला और ना ही उनके प्राकृतिक संपदा के दोहन से होने वाले फायदे में कोई हिस्‍सा। देखते ही देखते, बलूचिस्‍तान की प्राकृतिक संपदा पाकिस्‍तान की अर्थव्‍यवस्‍था की रीढ़ बन चुकी थी, लेकिन बलूचिस्‍तान कंगाली की गर्त में जा गिरा था। 

1948 से जारी है विद्रोह
बलूचिस्‍तान की जनसंख्या का एक बड़ा हिस्सा शुरू से ही स्वतंत्रता और स्वायत्तता की मांग करता रहा है। उन्होंने 1948 में पाकिस्तान के खिलाफ पहला विद्रोह शुरू किया। पाकिस्तान ने 1948 के विद्रोह को कुचल दिया। विद्रोह को तब भले ही दबा दिया गया, लेकिन ये कभी खत्म नहीं हुआ। बलूचिस्तान की आजादी के लिए शुरू हुए इस विद्रोह को नए नेता मिलते रहे। 1950, 1960 और 1970 के दशक में वे पाकिस्तान सरकार के लिए चुनौती बनते रहे। 2000 तक पाकिस्तान के खिलाफ चार बलूच विद्रोह हुए।

Dignexus: Your One-Stop Shop in Kolkata for Mobile App Development, Website Design, and Digital Marketing
 
Dignexus, a reputed company that excels in Data-Driven Digital Marketing, Custom Software Development, and Mobile App Development, is proud to commemorate ten years of success in the IT industry. They are one of the pioneers in IT consulting and development services and can boast of their ground-breaking solutions that enhance the growth of their clients and help them stay ahead of their competitors. 
The Vision Behind The Success So Far
Dignexus commenced its successful journey 10 years ago with a dream and vision to empower businesses with data-driven strategies and cutting-edge technology. So far they have worked with numerous companies from different niches and have been a part of their clients’ success stories.
The vast sphere of companies in which they have excelled includes healthcare, e-commerce, banking, education, automotive, travel, and both B2B and B2C sectors.
Empowering Clients for Success 
Dignexus' main focus and priority is to empower the clients and make their vision into a reality. The motto they abide by is helping the clients "win in their domain." That vision has always been the driving force behind the excellent teamwork of Dignexus. The skilled team is always eager to walk the extra mile to deliver more than expected. 
Dignexus’s industry-leading solutions and innovative approach are what make them stand apart from other companies. From designing engaging and efficient mobile applications to developing custom software tailored to specific business requirements, Dignexus makes sure its clients stay ahead in the cutthroat market of today.
Why Dignexus Is the Best Choice
Data-Driven Marketing
As the best Digital Marketing Agency in Kolkata, we can efficiently leverage the true power of analytics to create data-based campaigns that maximize ROI.
Custom Solutions: 
We do not believe in taking shortcuts just to deliver a sub-par project. Our team knows how to develop and deliver bespoke solutions, be it software or mobile apps tailored to our client’s unique needs.
Award-Winning Design: 
We have already earned our name and have been recognized as the best Website Design Company in Kolkata. We are known for creating visually stunning and user-friendly websites that enhance brand presence.
Proven Track Record
We have successfully completed a decade as one of the best solution-driven companies with a large number of clients applauding us.  
A Decade of Accomplishments
From empowering startups to simplifying operations for large corporations, Dignexus has been essential in helping companies succeed in their domains. The diverse industries represented in our portfolio demonstrate our capacity to adapt to the different needs of different clients. 
Looking Ahead
Dignexus is committed and ready to keep adding new feathers by setting new benchmarks in IT services. We believe in our unwavering focus on innovation and aim to drive digital transformation to the growth of businesses worldwide.
For more information about our services, feel free to:
Visit www.dignexus.com 
Contact us at Dignexus
Dignexus is a Kolkata-based IT consulting and development company specializing in Mobile App Development, Custom Software Development, and Data-Driven Digital Marketing. With 10 years of industry experience and an excellent team of skilled and dedicated professionals, Dignexus is focused on evolving to keep delivering world-class IT solutions that empower businesses to achieve their business goals.
_____________________