केरल में ईडी का बड़ा एक्शन, पूर्व सीएम विजयन के ठिकानों पर रेड, जानें क्या है पूरा मामला

#edraidformerkeralachiefministerpinarayivijayanhouse

केरल में सत्ता हाथ से निकलते ही पूर्व मुख्यमंत्री पिनाराई विजयन पर प्रवर्तन निदेशालय का शिकंजा कस गया है। ईडी ने कोचिन मिनरल्स एंड रूटाइल लिमिटेड (CMRL) घोटाले के मामले में बुधवार को बड़ी कार्रवाई की है। ईडी ने केरल में बड़े पैमाने पर छापेमारी शुरू कर दी है। जांच एजेंसी की टीमों ने 10 ठिकानों पर सर्च अभियान चलाया है, जिसमें मौजूदा विपक्ष के नेता और पूर्व मुख्यमंत्री पिनारई विजयन के आवास भी शामिल हैं।

सत्ता से बेदखल होने के बाद ईटी का शिकंजा

मनी लॉन्ड्रिंग मामले में पूर्व मुख्यमंत्री पिनरई विजयन से जुड़े ठिकानों समेत 10 जगहों पर छापेमारी की है। यह मामला सिर्फ एक कारोबारी लेनदेन तक सीमित नहीं दिख रहा बल्कि इसमें सत्ता, कॉरपोरेट और कथित वित्तीय गड़बड़ियों का बड़ा नेटवर्क सामने आने की आशंका जताई जा रही है। पिछले कुछ महीनों से विजयन परिवार पर विपक्ष लगातार हमलावर था। सरकार से बेदखल होने के बाद और अब ED की एंट्री ने इस पूरे विवाद को और ज्यादा गंभीर बना दिया है।

विवाद के केंद्र में विजयन की बेटी की कंपनी

ईडी पहले ही विजयन की बेटी टी वीना का बयान दर्ज कर चुकी है। वीना की आईटी कंपनी एक्सालॉजिक सॉल्यूशन इस पूरे विवाद के केंद्र में है। आरोप है कि कोचीन मिनरल्स एंड रूटाइल लिमिटेड (सीएमआरएल) नाम की एक प्राइवेट कंपनी ने साल 2018 से 2019 के बीच तत्कालीन सीएम विजयन की बेटी वीणा की कंपनी एक्सालॉजिक सॉल्यूशंस को 1.72 करोड़ रुपये का गैर-कानूनी पेमेंट किया, जबकि आईटी फर्म ने कंपनी को कोई सर्विस नहीं दी थी। ईडी की ये छापेमारी केरल हाई कोर्ट द्वारा मंगलवार को सीएमआरएल की उस याचिका को खारिज करने के बाद हुई, जिसमें इस मामले में ईडी की कार्रवाई को रद्द करने की मांग की गई थी।

हाईकोर्ट के फैसले के एक दिन बाद कार्रवाई

जानकारी के मुताबिक, बुधवार सुबह करीब 6 बजे ईडी की समन्वित कार्रवाई शुरू हुई। यह छापेमारी केरल हाईकोर्ट के उस फैसले के एक दिन बाद हुई, जिसमें अदालत ने ईडी को सीएमआरएल और एक्सालॉजिक के बीच कथित वित्तीय लेनदेन की जांच जारी रखने की अनुमति दी थी। एजेंसी ने केरल में एक साथ 10 ठिकानों पर तलाशी अभियान चलाया। इनमें तिरुवनंतपुरम के बेकरी जंक्शन के पास स्थित विजयन का किराए का आवास भी शामिल था, जहां टी वीना भी रहती हैं। इसके अलावा CMRL के दफ्तरों और कंपनी के वरिष्ठ अधिकारियों से जुड़े परिसरों पर भी छापेमारी की गई। CMRL के प्रबंध निदेशक ससिधरन कार्था से जुड़े ठिकाने भी जांच के दायरे में रहे।

वीडी सतीशन बने केरल के मुख्यमंत्री, 60 साल बाद पूरी कैबिनेट ने एक साथ ली शपथ

#vdsatheesantakeoathaskeralachiefminister

केरल में कांग्रेस नीत यूनाइटेड डेमोक्रेटिक फ्रंट (यूडीएफ) सरकार का सोमवार को शपथ ग्रहण। कांग्रेस नेता वीडी सतीशन ने सोमवार को तिरुवनंतपुरम के सेंट्रल स्टेडियम में आयोजित भव्य समारोह में केरल के मुख्यमंत्री पद की शपथ ली। इसके साथ ही एक दशक बाद कांग्रेस नीत यूडीएफ सरकार केरलम की सत्ता में वापस आ गई।

सीएम के साथ 21 सदस्यीय मंत्रिपरिषद का शपथ

केरल के राज्यपाल आरवी आर्लेकर ने सतीशन के साथ 21 सदस्यीय मंत्रिपरिषद को भी पद एंव गोपनीयता की शपथ दिलाई। तिरुवनंतपुरम में आयोजित भव्य समारोह में 60 साल बाद केरल में पूरी कैबिनेट एक साथ शपथ ली है।

कैबिनेट में 14 नए चेहरों को मौका मिला

वीडी सतीशन के नेतृत्व वाली 21 सदस्यीय कैबिनेट में 14 नए चेहरों को मौका मिला है। कांग्रेस कोटे से रमेश चेन्निथला, सनी जोसेफ, के मुरलीधरन, एपी अनिल कुमार, पीसी विष्णुनाध, रोजी एम जॉन, बिंदु कृष्णा, एम लिजू, टी सिद्दीकी, केए थुलसी और ओजे जनेश मंत्री बनेंगे। आईयूएमएल को पांच मंत्री पद मिले हैं। पार्टी की ओर से पीके कुन्हालिकुट्टी, केएम शाजी, वी अब्दुल गफूर, एन शम्सुद्दीन और पीके बशीर को कैबिनेट में जगह दी गई है। इसके अलावा मॉन्स जोसेफ, शिबू बेबी जॉन, अनूप जैकब और सीपी जॉन भी मंत्री पद की शपथ लीं।

शपथ ग्रहण में वंदे मातरम् की गूंज

शपथ ग्रहण कार्यक्रम में कांग्रेस अध्यक्ष मल्लिकार्जुन खरगे, राहुल गांधी और प्रियंका गांधी के अलावा कांग्रेस के तमाम बड़े नेता मौजूद रहे। इस शपथ ग्रहण समारोह की शुरुआत वंदे मातरम् गीत से हुई। वंदे मातरम मलयालम में गाया गया। उसके बाद जण गण मन हुआ और कार्यक्रम आगे बढ़ा

पिनराई विजय समेत मंच पर मौजूद रहे ये नेता

शपथ ग्रहण कर्नाटक के मुख्यमंत्री सिद्धारमैया और उपमुख्यमंत्री डीके शिवकुमार भी पहुंचे। तेलंगाना के सीएम रेवंत रेड्डी भी शपथ ग्रहण समारोह में मौजूद रहे। हिमाचल प्रदेश के मुख्यमंत्री सुखविंदर सिंह सुक्खू भी शपथ ग्रहण में मौजूद रहे। केरल के पूर्व मुख्यमंत्री पिनराई विजयन भी मंच पर नजर आए।

Best Bike Battery Shop in Aluva, Kerala | Green Energy Solutions

The performance of your bike depends on its battery condition during your daily commute and quick errands and long rides. The best bike battery shop in Aluva Kerala leads to a trusted destination which provides quality products and expert service and affordable pricing through its single location.

The Aluva shop has built a strong customer reputation because it provides reliable battery solutions which work for all bike and scooter types. The shop maintains its status as the most popular option in the area because it prioritizes product quality and customer happiness and delivers products which last for extended periods.

Wide Range of Bike Batteries for All Models

Every bike requires a specific type of battery based on its make, model, and usage. The shop provides complete bike battery solutions which serve various bike brands and engine specifications. The shop provides batteries which match your needs whether you own a commuter bike or sports bike or scooter.

The available batteries at this location deliver three key advantages which include high durability and fast charging and reliable performance. The customers have multiple options to choose from which allows them to meet their financial needs and product specifications.

High-Quality Products You Can Trust

The shop operates its business by using only authentic products which come from reliable manufacturers.

Every battery has been created to function effectively within the climate conditions of Kerala so it will achieve better performance and extended lifespan. The shop's dedication to maintaining high standards of excellence has established it as the leading bike battery store in Aluva, Kerala.

Expert Guidance for the Right Choice

Customers face difficulties selecting the appropriate bike battery because numerous products exist in the market. The experienced staff at this service center makes the process simple and hassle-free. The company provides basic information to customers which helps them select the best product for their specific needs based on their bike specifications and riding habits and budget restrictions.

The company aims to provide each customer with a battery which perfectly fits their requirements. The personalized service delivers two benefits because it enhances performance and extends the battery's operational time.

Fast Installation and Replacement Services

A dead bike battery can disrupt your entire day. The shop provides fast battery replacement services because customers need urgent service. Their trained technicians ensure proper installation, so your bike is ready to hit the road without delay.

Customers appreciate the fast service and professional approach, which saves both time and effort. The shop provides immediate solutions for both unexpected battery failures and scheduled replacement needs.

Affordable Pricing with Great Value

The shop distinguishes itself because of its affordable prices which create value for customers. The business maintains competitive prices through its high-quality products which remain accessible to customers. The service provides you with a budget-friendly option that allows you to maintain your desired level of quality.

The bike battery solutions from the shop provide reliable products which customers can access through regular offers and value deals to create better customer experiences.

More Than Just Bike Batteries

The store offers a variety of other goods and services in addition to its reputation as the greatest bike battery store in Aluva, Kerala. Among them are:

● Car batteries for every kind of vehicle

● Inverter systems for residences and workplaces

● Durable inverter batteries

● Inverter cards and associated parts

As a result, the store offers a full range of power solutions for both home and automobile applications.

Maintenance and Battery Care Support

The correct maintenance process serves as the essential method to extend bicycle battery lifespan. The shop provides both battery sales and essential maintenance services to its customers. Customers have the ability to schedule routine battery inspection and testing services which include maintenance work.

The team provides customers with useful battery care instructions which prevent typical problems and boost their battery efficiency. This additional assistance guarantees customers will experience sustained contentment and dependable service throughout time.

Easy Access Through Online Platform

The shop provides its customers with better accessibility through its user-friendly website which allows them to browse products and services. The online platform enables users to collect information while they conduct product comparisons and reach out to the customer support team

The shop operates a digital platform which demonstrates its dedication to contemporary customer requirements by providing users with straightforward methods to establish contact and interact with the business.

Trusted by Customers Across Aluva

The shop has developed a loyal customer base in Aluva and its neighboring areas through its business operations. The company has become a reliable market presence because of its dedication to delivering consistent product quality and providing honest service while prioritizing customer needs.

The shop delivers efficient and reliable service to its customers who need either new batteries or immediate battery replacements. The company has established a strong reputation which customers demonstrate through their positive word-of-mouth and their tendency to return.

Why Choose This Bike Battery Shop?

Here are some explanations for why this store is regarded as the top bike battery store in Aluva, Kerala:

● A large selection of bike batteries for every model

● Authentic and superior goods

● Professional advice and individualized care

● Fast replacement and installation

● Reasonably priced and excellent value

● More electricity options all under one roof

● Easy access to the internet

Because of these benefits, it is a dependable option for all local bike owners.

Conclusion

A continuous and relaxed riding experience is made possible with a dependable bike battery. Customers may purchase high-quality goods and expert support services from the top bike battery shop in Aluva, Kerala.

The Aluva shop delivers modern riders with affordable solutions while maintaining a strong commitment to customer satisfaction. The service center serves as your reliable source for complete bike battery solutions which include new battery purchases and replacement services and professional battery advice.

For more details: Visit Green Energy Solutions

Address: Green Energy Solutions, 157/2, Kallookkaran Building, Santhinagar Sreemoolanagaram P.O, Ernakulam District, Kerala 683580

Ph No: 8157946905

Published By,

Shaiju Mon K T | Click Crafters Technology

Bridal Makeup Artist Kerala | Redefining Bridal Beauty with Skin-Focused Perfection | Tony K. Michael

The weddings in Kerala showcase their sophistication through their traditional customs which create everlasting beauty. Every bride wants to achieve perfect beauty on her wedding day because the selection of an appropriate makeup artist will help her accomplish this goal. The industry recognizes Tony K. Michael as an expert who creates looks which combine natural beauty with perfect visual appeal for photography. He specializes in bridal, editorial, and celebrity makeup through his professional skills which combine artistic methods with current skin treatment techniques.Elevating Bridal Beauty in Kerala

The need for professional Bridal Makeup Artists in Kerala has increased because brides now prefer customized makeup instead of traditional heavy makeup. The modern bride requires two things which are makeup that improves her natural beauty and creates a stunning appearance in photographs and videos. Tony K. Michael understands this evolving trend and specializes in creating makeup that feels light on the skin yet looks stunning on every platform.

His signature approach focuses on skin preparation and enhancement rather than masking. The makeup process preserves the bride's natural glow which creates a perfect appearance that lasts until the wedding and its events are finished. His makeup techniques create a perfect match for traditional Kerala weddings and modern celebrations because they follow the bride's individual style and her chosen attire.

proficiency with Glass Skin Makeup, HD, and Airbrush

Tony is recognized as the top Airbrush Makeup Artist in Kerala because of his exceptional skills in advanced makeup techniques. HD makeup is designed to look perfect when viewed through high-definition cameras which makes it suitable for both weddings and professional photography. The process produces results which maintain perfect smoothness and complete refinement while eliminating all traces of imperfections.

Airbrush makeup delivers a weightless texture which maintains its effect throughout an extended period. The product has gained popularity among brides because it provides a sweat-proof and long-lasting appearance that remains intact during entire wedding events. Tony combines high-grade materials with his exacting instruments to create a natural-looking complexion that achieves a weightless effect.

The glass skin effect which has recently become a popular aesthetic trend represents one of his most distinctive artistic abilities. The technique seeks to produce a dewy finish which achieves luminous skin that reflects light. Instead of using thick, matte makeup, the approach gives brides a youthful, fresh appearance while preserving their natural radiance. Tony achieves radiant beauty through his combination of makeup skills and skincare expertise which he uses to create natural-looking results.

A Preferred Choice for Wedding and Celebrity Makeup

Artists who want to become recognized as Celebrity Makeup Artists in Kerala must prove their ability to create new designs while maintaining their professional work schedule. Tony K. Michael has built his reputation by working with diverse clients, including brides, models, and public figures. His understanding of various face shapes and skin colors and different lighting environments enables him to excel in his field.

The complete wedding service package he offers starts with his consultation service which provides trial sessions and custom wedding looks for all ceremonial events. The complete wedding package, which includes engagement ceremonies and wedding day events, features specific looks that designers developed to achieve their desired themes and costume designs. The bride achieves distinctiveness through his meticulous work which he applies to every aspect of her wedding festivities.

Personalized Approach for Every Bride

Brides have unique wedding day visions which Professional Makeup Artists in Kerala can help them achieve. Tony believes in working closely with his clients to understand their preferences, skin type, and comfort level. The makeup artist uses a personalized approach to create a look which enhances beauty and boosts confidence.

He combines traditional elements with modern elements for Hindu wedding ceremonies through his work. The Hindu Bridal Makeup expert from Kerala creates makeup which matches traditional Indian wedding attire that includes sarees and gold jewelry. The outcome creates a classic appearance which honors cultural traditions while incorporating modern fashion elements.

Why Brides Choose Tony K. Michael

There are several reasons why Tony continues to be a preferred Wedding Makeup Artist Kerala:

● Skin-Focused Techniques: The artist specializes in creating healthy skin which produces natural radiance without using heavy cosmetic products.

● Advanced Makeup Methods: The artist possesses specialized knowledge about HD makeup and airbrush techniques and glass skin makeup results.

● Customized Looks: The artist develops unique makeup designs which match the specific needs of each bride and her wedding events.

● Professional Experience: The artist works in three different fields which include bridal work and editorial work and celebrity work.

● Long-Lasting Results: The makeup product maintains its appearance throughout extended wedding celebrations.

He built a loyal customer base through his dedication to delivering high-quality work and satisfying client needs. The customer base he developed through his work has become his main source of business.

The Growing Demand for Premium Bridal Makeup in Kerala

Modern brides today have increased awareness about their existence on camera because social media platforms and high-definition photography have become popular. The industry now requires talented experts who can provide both visual appeal and technical skill to meet its current demands. The search patterns reveal that users consider Bridal Makeup Artist Kerala and Professional Makeup Artist Kerala to be essential terms for selecting the most suitable expert.

Tony K Michael provides a service that fulfills this requirement through his combination of artistic skills and exacting standards and his work ethic. His work not only enhances beauty but also captures the essence of each bride’s personality. He delivers premium makeup services to customers who want a high-end experience through his services in Kerala.

Conclusion

A wedding is one of the most memorable days in a person’s life, and every bride deserves to look and feel her best. The choice of a makeup artist who possesses both experience and expertise will determine the final results. Tony K. Michael uses his bridal and editorial and celebrity makeup skills to create new beauty standards for the state of Kerala.

Brides in Kerala who need a reliable Bridal Makeup Artist should choose him because he delivers high-quality services with elegant and innovative results. He creates both timeless and contemporary beauty results which allow brides to achieve confident looks for their special day.

For more details: Tony K. Michael / Kochi, Kerala, India

Published By,

Shaiju Mon K T / Click Crafters Technology

​Boardrooms to Film Sets: Rajesh Babu K Sooranad Expands Creative Footprint in Malayalam Cinema

Kozhikode: The inspiring journey of Rajesh Babu K Sooranad continues to gain momentum as the multi-talented creative professional strengthens his presence in the Malayalam film industry. Transitioning from a successful career in human resources to cinema, Sooranad is now making his mark as a music director, producer, singer, and filmmaker.

Hailing from Sooranad village in Kerala's Kollam district, his story reflects determination, versatility, and a deep passion for storytelling. Over the years, he has steadily built a reputation for his creative excellence while maintaining a strong foundation in management and leadership.

Strong Portfolio as Music Director

​In a significant achievement, Rajesh Babu K Sooranad has completed work on 20 films as a music director, marking a consistent rise in his musical journey. His compositions are known for their emotional depth, blending traditional Malayalam elements with modern cinematic sound.

​His notable projects include Perfume: Her Fragrance, Anandakalyanam, Binary, and Zha – The Incessant Rain, all of which have contributed to his growing recognition in the industry.

Expanding Role as Film Producer

​Alongside music, Sooranad has also emerged as a proactive film producer. Under his banner, VOC Media Private Limited, he has produced six films, supporting independent cinema and new talent.

​Among these, Perfume: Her Fragrance, Binary, and Zha – The Incessant Rain have already been released and have received attention for both their storytelling and musical quality. Meanwhile, his upcoming films—INI: The Unknown Tomorrow, Better Half, and Ennum: Forever—are currently in the post-production stage, creating anticipation among audiences and industry observers.

Directorial Debut with Ennum: Forever

​In a major milestone, Rajesh Babu K Sooranad is stepping into direction with his first directorial venture, Ennum: Forever. The project holds special significance as he is writing, directing, and producing the film himself.

​This move marks his evolution into a complete filmmaker and highlights his growing influence in the Malayalam cinema landscape.

A Voice Beyond Composition

​Beyond films, Sooranad has also made a strong impression as a singer and independent music creator. He has released 10 music albums, contributing both as composer and vocalist.

​His albums—including A Tribute to Kerala 60, Hridayame, Ponnonam, Ente Keralam, Nammude Kozhikode, Miss You Maveli, Makarachyothi, Sangeetha Samrajya, Karppooradeepam, and Perunnal Nilavu—reflect Kerala's cultural richness and emotional depth, resonating widely with audiences.

Blending Management with Creativity

​What distinguishes Sooranad is his ability to merge his HR expertise with creative execution. His background in HR and competence in Team Management have helped him efficiently coordinate productions and mentor emerging talent.

​Through his projects, he has opened doors for numerous new artists and technicians, reinforcing his reputation as a creator who believes in giving back to the industry.

Recognition and Future Outlook

​With growing recognition, including accolades for music direction and increasing visibility on OTT and theatrical platforms, Sooranad is steadily building a strong creative ecosystem. His upcoming films are expected to further strengthen his position, while his continued work in independent music keeps him connected to grassroots audiences.

A Modern Multi-Talent

​Rajesh Babu K Sooranad's journey exemplifies how passion and discipline can lead to success across multiple domains. From HR professional to filmmaker, his evolution reflects the changing face of Indian cinema.

​As Malayalam cinema continues to expand globally, his growing body of work positions him as one of the promising multi-faceted talents to watch in the coming years.

​Visit for more :

https://www.instagram.com/rajeshbabuksooranad?utm_source=qr&igsh=MTRmY2prMzduNGN5bQ==

​Face book : https://www.facebook.com/share/1E8zmcX7FD/

देश के दो राज्यों और एक केंद्र शासित प्रदेश में मतदान, केरल-असम और पुदुचेरी में वोटिंग जारी

#keralaassampuducherryvidhansabhachunav_voting

आज देश के दो राज्यों और एक केंद्र शासित प्रदेश में विधानसभा चुनाव के लिए मतदान है। आज असम, केरल और केंद्र शासित प्रदेश पुदुचेरी में विधानसभा चुनाव है। असम की 126, केरल की 140 और पुदुचेरी की 30 सीटों पर उम्मीदवारों अपनी किस्मत आज ईवीएम में कैद हो जाएगी।

असम में कुल 2.5 करोड़ मतदाता हैं, जिनमें 1.25 करोड़ पुरुष, 1.25 करोड़ महिलाएं और 343 थर्ड जेंडर मतदाता शामिल हैं। 126 सीटों पर 722 उम्मीदवार चुनाव लड़ रहे हैं। वहीं, केरल में 140 सीटों के लिए 883 उम्मीदवार मैदान में हैं। राज्य में कुल 2.71 करोड़ मतदाता हैं, जिनमें 1.32 करोड़ पुरुष, 1.39 करोड़ महिलाएं और 273 थर्ड जेंडर वोटर्स शामिल हैं। पुदुचेरी में 30 विधानसभा सीटों पर मतदान होगा, जिनमें 5 सीटें अनुसूचित जाति के लिए आरक्षित हैं। पुदुचेरी में कुल 9.50 लाख मतदाताओं में करीब 4.46 लाख पुरुष, 5.03 लाख महिलाएं और 139 थर्ड जेंडर मतदाता शामिल हैं।

पीएम मोदी ने असम के लोगों से की खास अपील

पीएम मोदी ने असम के लोगों से भी खास अपील की है। आज असम की 126 विधानसभा पर वोट डाले जा रहे हैं। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, '2026 के असम विधानसभा चुनावों के लिए मतदान प्रक्रिया शुरू होने के संदर्भ में, मैंने असम की जनता से बड़ी संख्या में बाहर आकर अपने मताधिकार का प्रयोग करने की अपील की है। मुझे उम्मीद है कि राज्य के युवा, पुरुष और महिला मतदाता पूरे उत्साह के साथ इसमें भाग लेंगे और इस चुनाव को लोकतंत्र तथा नागरिक कर्तव्य के एक उत्सव में बदल देंगे।'

पीएम मोदी की केरल के लोगों से खास अपील

केरल की 140 विधानसभा सीटों के लिए वोटिंग हो रही है। इस बीच पीएम मोदी ने केरल के लोगों से खास अपील की है। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, 'मैं केरल के लोगों से 2026 के विधानसभा चुनावों में बड़ी संख्या में मतदान करने का आह्वान करता हूं। रिकॉर्ड भागीदारी केरल की लोकतांत्रिक भावना को और अधिक मजबूती प्रदान करेगी। मैं विशेष रूप से राज्य के युवाओं और महिलाओं से आग्रह करता हूं कि वे आगे आएं और बड़ी संख्या में मतदान करें।

पुडुचेरी के मतदाताओं से लिए पीएम मोदी का पोस्ट

केंद्र शासित प्रदेश पुडुचेरी की 30 सीटों पर वोटिंग हो रही है। पीएम मोदी ने पुडुचेरी के लोगों से खास अपील की है। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, 'जैसे ही पुडुचेरी विधानसभा चुनाव शुरू हो रहे हैं, मैं हर मतदाता से आग्रह करता हूं कि वे बाहर निकलें और रिकॉर्ड संख्या में मतदान में हिस्सा लें। मैं विशेष रूप से हमारे युवाओं और महिला मतदाताओं से अपील करता हूं कि वे लोकतंत्र की प्रक्रिया को मजबूत करें। पुडुचेरी के भविष्य को संवारने में हर एक वोट मायने रखता है।'

Top SEO Services Company in Thrissur, Kerala| Click Crafters Technology

Businesses today require more than an online presence because they must establish their visibility and credibility while generating leads with consistency. The most effective method to achieve this goal has become Search Engine Optimization (SEO). The professional SEO service market experiences continuous growth because businesses in Kerala increasingly adopt digital platforms.Click Crafters Technology successfully maintains its position in the changing marketplace as a developing brand that provides customers with dependable digital services.Shaiju Mon K T established Click Crafters Technology ( ISO 9001:2015 certified ) in Thrissur with the goal of helping businesses create strong digital identities through their specialized digital services. The company provides SEO services together with Meta Ads and WordPress website development to existing customers who want to find the best Kerala SEO services company to support their business needs.

The Rising Importance of SEO in Kerala’s Business Landscape

The state of Kerala has experienced substantial growth through its development of internet-based enterprises and startup companies and various service providers. Every business from local shops to service-based companies and e-commerce brands aims to achieve first-page Google results. This is where SEO plays a crucial role.

Search Engine Optimization enables websites to achieve higher ranking positions on search engines which results in improved business discovery by potential customers. The team at Click Crafters Technology develops SEO solutions that achieve practical results while maintaining compliance with current search engine standards.

Their SEO services have been developed to achieve three primary objectives which include:

● Google ranking improvement

● Website traffic growth through organic methods

● Acquisition of high-quality business leads

● Increased brand recognition

● Achievement of sustainable digital expansion

The company functions as the leading option for businesses that seek the best SEO services in Kerala India.

Comprehensive SEO Services for Business Growth

Click Crafters Technology provides complete SEO services which they customize for various business sectors. Their approach begins with understanding the client’s business, target audience, and competition.

Their key SEO services include:

● Keyword Research: The process of finding valuable keywords which customers use to conduct their searches

● On-Page SEO: The process of enhancing website content through better meta tags and headings and structural optimization

● Technical SEO: The process of enhancing website performance through better speed and mobile usability and increased crawlability

● Off-Page SEO: The process of creating high-quality backlinks which boost a website's domain authority

● Local SEO: The service helps businesses achieve better rankings in local search results and on Google Maps

● Content Strategy: The development of SEO-optimized content which attracts and keeps users interested

The company provides clients with sustainable search engine rankings through techniques which drive consistent traffic development.

WordPress Website Development – Building the Foundation

A strong SEO strategy begins with a website that has been developed through proper website development. Click Crafters Technology specializes in WordPress website development, creating websites that are not only visually appealing but also optimized for search engines.

Their WordPress services include:

● Business website development

● E-commerce website creation

● SEO-friendly website design

● Mobile responsive layouts

● Fast loading websites

● Custom website solutions

A properly designed website improves user experience, reduces bounce rates, and supports better SEO performance. This integration of website development and SEO provides clients with a strong digital foundation.

Meta Ads – Boosting Reach Through Paid Campaigns

Businesses achieve fast visibility through paid advertising, while SEO delivers results that last over extended periods. Click Crafters Technology provides businesses with Meta Ads services that include Facebook and Instagram advertising to help them reach their desired audience without delay.

Their Meta Ads services include:

● Campaign planning and setup

● Audience targeting and segmentation

● Creative ad design

● Lead generation campaigns

● Website traffic campaigns

● Performance monitoring and optimization

Businesses can achieve immediate growth through Meta Ads while developing their brand identity and obtaining new customers through SEO.

A Complete Digital Growth Partner

Click Crafters Technology provides comprehensive digital solutions which serve as its main competitive advantage. Businesses do not have to depend on multiple agencies for different services. The company provides all services from website development to SEO and advertising through its unified service model.

Their integrated services include:

● WordPress website development

● Search Engine Optimization

● Facebook and Instagram Ads

● Website redesign and maintenance

● Digital marketing strategy

The unified system produces enhanced coordination which results in better outcomes and creates a smooth experience for all clients.

Supporting Businesses Across Kerala

Click Crafters Technology has been working with different types of clients which include both startups and small businesses as well as established companies. The company develops personalized solutions which are tailored to meet the specific needs of each client.

Digital marketing has become essential for Kerala businesses as they recognize its value. SEO enables their appearance in search results when customers search for their services. A professional website establishes trustworthiness while social media advertising enables businesses to reach a wider audience.

Click Crafters Technology uses these elements to help businesses achieve the following goals:

● Increase their online visibility

● Generate new business inquiries and potential customers

● Establish their brand as trustworthy

● Improve their ability to compete in the marketplace

Vision for the Future

Click Crafters Technology, led by Shaiju Mon K T, plans to expand its services to establish itself as one of Kerala's most trustworthy digital marketing companies. The company maintains its ongoing commitment to investigate contemporary developments in SEO and website development and digital advertising.

The company exists to help all businesses succeed in online marketing through its mission which delivers accessible and effective digital marketing solutions. The company exists to help all businesses succeed in online marketing through its mission which delivers accessible and effective digital marketing solutions.

Conclusion

Businesses achieve online success through their ability to establish online visibility. SEO serves three key functions because it produces organic website traffic while establishing customer trust and driving business development for extended periods. The combination of a business website which functions properly together with its advertising system delivers exceptional outcomes.

The Top SEO Services Company in Kerala India search continues for businesses which makes Click Crafters Technology the best choice because it provides dependable results through its SEO and WordPress website development and Meta Ads services.

Click Crafters Technology establishes digital presence for businesses in Kerala through its dedication to quality which results in customer satisfaction. The company helps businesses achieve online sustainable growth through its digital services.

For more details: Visit Click Crafters Technology

Ph No: 8891925986

Address: 21/811, Kadicheeni Complex, 1 Floor, Trunk Rd, North Chalakudy, Chalakudy, Kerala 680307

Fashion consulting services in Kerala, India | SG TEX AND CO

The fashion industry is changing quickly because multiple brands today choose sustainable fashion and ethical fashion. Customers who understand environmental issues now choose to buy high-quality clothing which brands make through ethical production methods. The need for sustainable clothing production in Kerala India has grown because of this trend. SG TEX AND CO operates from Chavakkad to support sustainable fashion practices which are being adopted by the fashion industry.

 

SG TEX AND CO partners with fashion brands and boutiques and designers to create sustainable clothing and high-quality womenswear and handbags and home textile products which follow responsible manufacturing methods.

Fashion Consulting Services in Kerala, India

It's difficult to launch a fashion brand. Many people have creative concepts, but they are unsure of how to turn them into completed clothing. Designers and brands can better grasp the entire garment production process with the aid of fashion consultancy services.

 

In Kerala, India, SG TEX AND CO offers fashion consulting services for:

 

●     Fashion startups

●     Boutique apparel companies

●     Designers of fashion

●     Clothing brands

●     Online retailers of apparel

●     Companies that export clothing

 

The business assists customers with product creation, production planning, fabric selection, sample, and clothing manufacture.

Premium Womenswear Manufacturer Support

The company dedicates its main business activities to producing high-quality women's clothing. Contemporary fashion brands prioritize producing high-end apparel instead of creating products for widespread distribution. Designers create premium clothing through their selection of high-quality materials and their execution of precise stitching techniques and their application of proper finishing methods and their completion of intricate design details.

 

SG TEX AND CO supports brands as a premium womenswear manufacturer by helping them develop premium dresses, tops, ethnic wear, designer wear, and boutique clothing collections. The organization provides assistance throughout the entire process starting from the first sample until the production reaches completion.

 

This support system provides essential assistance to boutique brands and designers who require high-quality garments that they need to produce in small or medium-sized quantities.

Garment Manufacturer and Custom Womenswear Maker

In Kerala, SG TEX AND CO also produces clothing and custom apparel. Custom-designed clothing is preferred by many brands over pre-made outfits. According to the client's specifications for design, fabric, size, and finishing, the company enables the creation of custom clothing.

 

Production of custom womenswear comprises:

 

●     Making patterns

●     Development of a sample

●     Sourcing of fabrics

●     Stitching, embroidery, finishing, and packing

 

Startup brands and expanding fashion companies benefit from the company's support for both small batch and large production orders.

Apparel Sourcing Company in India

The primary obstacle that fashion brands face involves their fabric and accessory sourcing needs. SG TEX AND CO operates as an apparel sourcing company which assists brands in obtaining fabrics, trims, embroidery materials, buttons, zippers, and other garment accessories from India.

 

India is recognized for its production of cotton fabrics, handloom fabrics, embroidery fabrics, and sustainable textiles. The company helps clients choose the right fabric based on their design, budget, and garment type.

 

The company provides complete fashion production services through its dual functions of apparel sourcing and garment manufacturing.

Boutique Clothing Manufacturer and Hand Embroidery Garment Production

Boutique clothing production requires more attention to detail compared to mass garment production. SG TEX AND CO works as a boutique clothing manufacturer supporting designers and boutique brands.

 

The company offers production services for hand embroidery on garments. Hand embroidery is widely used in designer wear, bridal wear, ethnic wear, and premium garments. Skilled workers do detailed embroidery work carefully to maintain quality and design accuracy.

 

Hand embroidery adds more value to garments and makes them unique, which is very important for boutique fashion brands.

Sustainable Apparel Production Support

Fashion brands today direct their efforts toward sustainable fashion and slow fashion production methods. The sustainable production of apparel requires brands to use responsible fabric sourcing and implement small batch production methods while minimizing waste and following ethical manufacturing practices.

 

SG TEX AND CO supports sustainable apparel production by focusing on quality garments instead of mass production. This solution provides significant assistance to sustainable fashion brands and environmentally friendly clothing brands.

 

The company supports brands that want to produce handmade garments, slow fashion collections, and sustainable clothing products.

Handbag Manufacturer and Home Textile Manufacturing Company

In addition to clothing, SG TEX AND CO is a handbag and home textile maker. A lot of fashion firms seek to include handbags and home textiles to their product line.

 

The business produces:

 

●     Handbags made of fabric

●     Personalized purses

●     Covers for cushions

●     Textile goods for the home

●     Accessories made of textiles

 

This makes it easier for fashion brands to collaborate with a single business to manufacture various textiles and fashion items.

Complete Fashion Production Partner

SG TEX AND CO is more than just a clothing company. The business serves as a full-service partner in fashion production by offering:

 

●     Consulting services for fashion

●     High-end production of women's clothing

●     Production of clothing

●     Production of custom womenswear

●     Services for sourcing clothing

●     Manufacturing of boutique apparel

●     Production of clothing via hand embroidery

●     Eco-friendly clothing manufacturing

●     Production of handbags

●     Manufacturing textiles at home

 

Because of this, the business is highly beneficial to up-and-coming fashion firms and designers that require full support from conception to finished product.

Conclusion

The fashion industry requires proper planning, fabric sourcing, sampling, production, and quality control. Multiple fashion brands experience failure because they lack adequate production backing and operational support. The fashion consulting services assist brands in learning about the entire garment production method while they protect themselves from production errors.

 

SG TEX AND CO, located in Chavakkad, Kerala, provides fashion consulting services in Kerala, India along with garment manufacturing, premium womenswear production, apparel sourcing, boutique clothing manufacturing, hand embroidery garment production, sustainable apparel production, handbag manufacturing, and home textile manufacturing.

 

The company establishes itself as a trustworthy fashion consulting and garment manufacturing partner for fashion brands by providing design assistance and complete production support.

 

SG TEX AND CO provides fashion consulting services to fashion brands and designers in Kerala India through their professional guidance and garment production support and complete fashion manufacturing solutions.

 

For More Details : SG TEX, 17/140, Business Tower, Chavakkad, Thrissur , Kerala, 680506. Ph No: 9769286666. Website: www.sgtexco.com

 

Published By,

Shaiju Mon K T | Click Crafters Technology

 

 

Premium Womenswear Manufacturer in Kerala, India | SG TEX AND CO

The fashion industry is experiencing rapid growth which leads multiple fashion brands to search for dependable clothing manufacturers in India. Premium womenswear manufacturing stands as one of the essential divisions that make up the fashion industry. Modern brands now emphasize three key elements which include product quality, distinctive design patterns, and fabric comfort combined with flawless product finishing. The business of SG TEX AND CO operates as a major premium womenswear manufacturing company in Kerala which delivers its services across India.SG TEX AND CO operates from its Chavakkad location to deliver multiple services which include premium womenswear manufacturing, garment production, hand embroidery garment production, apparel sourcing, handbag manufacturing, and home textile manufacturing to fashion brands and boutiques and designers who operate in India and international markets.

Growing Demand for Premium Womenswear Manufacturing in India

The demand for high-end womenswear has grown substantially during the past few years. Customers now want to buy high-quality clothing instead of purchasing fast fashion items. The premium clothing sector establishes its product standards through an assessment of material excellence and stitching expertise and finishing techniques and distinct design elements. Fashion brands currently seek trustworthy manufacturers who produce high-quality womenswear in Kerala India.

Kerala has a reputation for producing skilled workers who specialize in tailoring and textile and embroidery and garment manufacturing. Kerala-based garment manufacturers attract fashion brands because they produce premium clothing through precise work and high-quality results.

SG TEX AND CO provides garment manufacturing services which assist premium fashion brands through their business operations.

Premium Womenswear Manufacturing Services

The business of SG TEX AND CO operates primarily through its production of high-quality women's clothing which it creates for fashion retailers and boutique stores. The company manufactures different types of womenswear including dresses, tops, ethnic wear, boutique collections, designer wear, and custom-designed garments.

The company supports clients from the beginning stage itself. Their services include:

● Design support

● Pattern making

● Sample development

● Fabric sourcing

● Garment production

● Hand embroidery work

● Quality checking

● Packing and finishing

● Cut and make services

The full process enables fashion brands to develop their clothing collections because they do not need to handle any production-related problems.

Custom Womenswear Production for Fashion Brands

Many fashion designers and boutique owners want custom garment production in small quantities. SG TEX AND CO accepts both small orders and large production orders because not all manufacturers do so.

This service provides multiple advantages to:

● Boutique clothing brands

● Startup fashion brands

● Online clothing brands

● Fashion designers

● Export garment brands

The custom womenswear manufacturing process includes custom designs and custom fabrics and custom embroidery and custom sizes which match the brand requirements.

Hand Embroidery and Premium Garment Finishing

Premium womenswear requires more than sewing because it needs hand embroidery and detailed work and final production inspection. The hand embroidery service of SG TEX AND CO enables premium garment production which enhances the value of these high-quality products.

Hand embroidery is commonly used in the following fashion categories:

● Designer wear

● Bridal wear

● Boutique collections

● Ethnic wear

● Premium fashion garments

The company employs trained personnel who execute complex embroidery work with precision to achieve high-quality results and authentic design representation.

Apparel Sourcing and Fabric Support

Fashion brands face major difficulties because they need to find both fabrics and materials for their operations. SG TEX AND CO offers apparel sourcing services which assist clients in finding fabrics and trims and accessories and all other materials that they need for their garment production needs.

India is recognized as a source of cotton fabrics and embroidery fabrics and sustainable fabrics and handloom fabrics. SG TEX AND CO assists clients in selecting suitable fabrics that match their design requirements and budget constraints. In India similar fabrics are available in different quality. our experts ensure that the top quality fabrics and trims/ accessories are sourced.

The company operates as a total fashion production partner because it provides more services than just manufacturing garments.

Sustainable and Slow Fashion Production

Today many fashion brands are focusing on sustainable fashion and slow fashion production. Slow fashion means producing quality garments in small quantities with less waste and better working conditions.

SG TEX AND CO supports sustainable apparel production and slow fashion brands by focusing on quality production instead of mass production. They support brands that want eco-friendly clothing, handmade garments, and ethical fashion production.

Many premium fashion brands choose to work with smaller garment manufacturers who focus on producing high-quality products.

Handbags and Home Textile Manufacturing

SG TEX AND CO produces premium womenswear and various products that include handbags and home textile items. Fashion brands show interest in expanding their product lines to include handbags and cushion covers and textile products.

The company supports clients in manufacturing:

● Fabric handbags

● Custom handbags

● Cushion covers

● Home textile products

● Textile accessories

This enables fashion brands to use a single production partner for all their product needs.

Premium Womenswear Manufacturer in Kerala, India

The fashion industry in Kerala India needs premium womenswear manufacturers who meet standards of quality and reliability and production flexibility and industry experience. SG TEX AND CO provides all these services and supports brands from design to final production.

The company in Kerala uses its location to access skilled workers who include embroidery workers and tailoring unit staff and textile resources. This enables them to deliver premium garments to their clients while maintaining high-quality standards.

The company serves Indian fashion brands and international clients who require garment manufacturing and apparel sourcing services from India.

Conclusion

The fashion industry requires dependable production partners who possess expertise in high-end fashion and garment quality and bespoke clothing manufacturing. SG TEX AND CO operates from Chavakkad, Kerala, as a developing premium womenswear manufacturer that provides support to various fashion brands and boutiques and designers and apparel companies in India.

The company expands its capabilities as a full fashion production partner through its offerings of premium garment manufacturing and custom womenswear production and hand embroidery garment production and apparel sourcing and handbag manufacturing and home textile production services.

SG TEX AND CO delivers dependable and high-quality professional garment manufacturing services to fashion brands that require a premium womenswear manufacturer based in Kerala India.

For More Details : SG TEX, 17/140, Business Tower, Chavakkad, Thrissur , Kerala, 680506. Ph No: 9769286666. Website: www.sgtexco.com

Published By,

Shaiju Mon K T | Click Crafters Technology

'द केरल स्टोरी-2' को ज्यादा दर्शक न मिलना 'अच्छी खबर', राहुल गांधी बोले-फिल्मों का इस्तेमाल प्रचार के लिए हो रहा

#rahulgandhisaysthekeralastory2notattractingmanyviewersisgood_news

कांग्रेस नेता राहुल गांधी ने कहा है कि यह "अच्छी खबर" है कि विवादित फिल्म 'द केरल स्टोरी-2 गोज बियॉन्ड' को ज्यादा दर्शक नहीं मिल रहे हैं। राहुल गांधी ने शुक्रवार को कुट्टिक्कानम के मारियन कॉलेज में छात्रों से बातचीत करते हुए ये बयान दिया।

फिल्मों को दुष्प्रचार का साधन बनाए जाने के बारे में एक छात्र के प्रश्न का उत्तर देते हुए गांधी ने ‘केरल स्टोरी-2 गोज बियॉन्ड’ पर अपने विचार साझा किए। राहुल गांधी ने कहा कि अच्छी खबर यह है कि ‘केरल स्टोरी’ वाले सिनेमाघरों में सीट खाली पड़ी हैं, और इसे कोई देख नहीं रहा है। यह दिखाता है कि ऐसे लोग हैं, जिनमें से अधिकांश को केरल और उसकी परंपराओं तथा संस्कृति की समझ नहीं है।

फिल्मों-टेलीविजन और मीडिया का राजनीतिक इस्तेमाल

राहुल के अनुसार, फिल्मों, टेलीविजन और मीडिया को तेजी से ‘हथियार’ के रूप में इस्तेमाल किया जा रहा है। राहुल गांधी ने कहा कि सिनेमा, टेलीविजन और मीडिया का इस्तेमाल राजनीतिक संदेश फैलाने के लिए तेजी से किया जा रहा है। उन्होंने कहा, “इसका इस्तेमाल ठीक इसी उद्देश्य से किया जाता है— लोगों को बदनाम करने, उन्हें समाज से अलग करने और समाज में फूट डालने के लिए, ताकि कुछ लोगों को फायदा हो और दूसरों को नुकसान। भारत भी कुछ ऐसा ही बन चुका है।

इस तरह के घटनाक्रम के लिए बड़ी खर्च हो रहा-राहुल गांधी

कांग्रेस सांसद का दावा है किया कि इस तरह के घटनाक्रम देश के लिए हानिकारक थे और इस उद्देश्य के लिए बड़ी मात्रा में धन खर्च किया जा रहा था। उन्होंने कहा कि अगर कोई इंसान किसी खास तरह की फिल्म बनाना चाहता है, मीडिया में कुछ कहना चाहता है, या किसी खास आइडिया को डिफेंड करना चाहता है, तो उन पर हमला किया जाता है और अक्सर उन्हें बोलने नहीं दिया जाता। राहुल ने कहा कि मैं यह हर समय महसूस करता हूं। दूसरी तरफ, कुछ कहानियों को लोग जितना चाहें उतना फैला सकते हैं और उनका कुछ नहीं होता।

देश की शिक्षा प्रणाली पर वैचारिक दबाव-राहुल गांधी

राहुल गांधी ने कहा कि केरल में समृद्ध सांस्कृतिक परंपराएं हैं और उन्होंने छात्रों से आग्रह किया कि वे इन परंपराओं से जुड़े रहें और साथ ही दुनिया के अन्य हिस्सों से भी सीखें। उन्होंने यह भी चिंता व्यक्त की कि देश की शिक्षा प्रणाली वैचारिक दबाव का सामना कर रही है। उन्होंने कहा, “यदि आप विश्वविद्यालयों के कुलपतियों को देखें, तो उनमें से बड़ी संख्या में नियुक्तियां केवल इसलिए की गई हैं क्योंकि वे आरएसएस या किसी विशेष विचारधारा का हिस्सा हैं। शिक्षा प्रणाली पर वैचारिक दबाव है। शिक्षा किसी विशेष विचारधारा तक सीमित नहीं होनी चाहिए, विशेष रूप से आरएसएस के विभाजनकारी दृष्टिकोण तक तो बिल्कुल नहीं।”

केरल में ईडी का बड़ा एक्शन, पूर्व सीएम विजयन के ठिकानों पर रेड, जानें क्या है पूरा मामला

#edraidformerkeralachiefministerpinarayivijayanhouse

केरल में सत्ता हाथ से निकलते ही पूर्व मुख्यमंत्री पिनाराई विजयन पर प्रवर्तन निदेशालय का शिकंजा कस गया है। ईडी ने कोचिन मिनरल्स एंड रूटाइल लिमिटेड (CMRL) घोटाले के मामले में बुधवार को बड़ी कार्रवाई की है। ईडी ने केरल में बड़े पैमाने पर छापेमारी शुरू कर दी है। जांच एजेंसी की टीमों ने 10 ठिकानों पर सर्च अभियान चलाया है, जिसमें मौजूदा विपक्ष के नेता और पूर्व मुख्यमंत्री पिनारई विजयन के आवास भी शामिल हैं।

सत्ता से बेदखल होने के बाद ईटी का शिकंजा

मनी लॉन्ड्रिंग मामले में पूर्व मुख्यमंत्री पिनरई विजयन से जुड़े ठिकानों समेत 10 जगहों पर छापेमारी की है। यह मामला सिर्फ एक कारोबारी लेनदेन तक सीमित नहीं दिख रहा बल्कि इसमें सत्ता, कॉरपोरेट और कथित वित्तीय गड़बड़ियों का बड़ा नेटवर्क सामने आने की आशंका जताई जा रही है। पिछले कुछ महीनों से विजयन परिवार पर विपक्ष लगातार हमलावर था। सरकार से बेदखल होने के बाद और अब ED की एंट्री ने इस पूरे विवाद को और ज्यादा गंभीर बना दिया है।

विवाद के केंद्र में विजयन की बेटी की कंपनी

ईडी पहले ही विजयन की बेटी टी वीना का बयान दर्ज कर चुकी है। वीना की आईटी कंपनी एक्सालॉजिक सॉल्यूशन इस पूरे विवाद के केंद्र में है। आरोप है कि कोचीन मिनरल्स एंड रूटाइल लिमिटेड (सीएमआरएल) नाम की एक प्राइवेट कंपनी ने साल 2018 से 2019 के बीच तत्कालीन सीएम विजयन की बेटी वीणा की कंपनी एक्सालॉजिक सॉल्यूशंस को 1.72 करोड़ रुपये का गैर-कानूनी पेमेंट किया, जबकि आईटी फर्म ने कंपनी को कोई सर्विस नहीं दी थी। ईडी की ये छापेमारी केरल हाई कोर्ट द्वारा मंगलवार को सीएमआरएल की उस याचिका को खारिज करने के बाद हुई, जिसमें इस मामले में ईडी की कार्रवाई को रद्द करने की मांग की गई थी।

हाईकोर्ट के फैसले के एक दिन बाद कार्रवाई

जानकारी के मुताबिक, बुधवार सुबह करीब 6 बजे ईडी की समन्वित कार्रवाई शुरू हुई। यह छापेमारी केरल हाईकोर्ट के उस फैसले के एक दिन बाद हुई, जिसमें अदालत ने ईडी को सीएमआरएल और एक्सालॉजिक के बीच कथित वित्तीय लेनदेन की जांच जारी रखने की अनुमति दी थी। एजेंसी ने केरल में एक साथ 10 ठिकानों पर तलाशी अभियान चलाया। इनमें तिरुवनंतपुरम के बेकरी जंक्शन के पास स्थित विजयन का किराए का आवास भी शामिल था, जहां टी वीना भी रहती हैं। इसके अलावा CMRL के दफ्तरों और कंपनी के वरिष्ठ अधिकारियों से जुड़े परिसरों पर भी छापेमारी की गई। CMRL के प्रबंध निदेशक ससिधरन कार्था से जुड़े ठिकाने भी जांच के दायरे में रहे।

वीडी सतीशन बने केरल के मुख्यमंत्री, 60 साल बाद पूरी कैबिनेट ने एक साथ ली शपथ

#vdsatheesantakeoathaskeralachiefminister

केरल में कांग्रेस नीत यूनाइटेड डेमोक्रेटिक फ्रंट (यूडीएफ) सरकार का सोमवार को शपथ ग्रहण। कांग्रेस नेता वीडी सतीशन ने सोमवार को तिरुवनंतपुरम के सेंट्रल स्टेडियम में आयोजित भव्य समारोह में केरल के मुख्यमंत्री पद की शपथ ली। इसके साथ ही एक दशक बाद कांग्रेस नीत यूडीएफ सरकार केरलम की सत्ता में वापस आ गई।

सीएम के साथ 21 सदस्यीय मंत्रिपरिषद का शपथ

केरल के राज्यपाल आरवी आर्लेकर ने सतीशन के साथ 21 सदस्यीय मंत्रिपरिषद को भी पद एंव गोपनीयता की शपथ दिलाई। तिरुवनंतपुरम में आयोजित भव्य समारोह में 60 साल बाद केरल में पूरी कैबिनेट एक साथ शपथ ली है।

कैबिनेट में 14 नए चेहरों को मौका मिला

वीडी सतीशन के नेतृत्व वाली 21 सदस्यीय कैबिनेट में 14 नए चेहरों को मौका मिला है। कांग्रेस कोटे से रमेश चेन्निथला, सनी जोसेफ, के मुरलीधरन, एपी अनिल कुमार, पीसी विष्णुनाध, रोजी एम जॉन, बिंदु कृष्णा, एम लिजू, टी सिद्दीकी, केए थुलसी और ओजे जनेश मंत्री बनेंगे। आईयूएमएल को पांच मंत्री पद मिले हैं। पार्टी की ओर से पीके कुन्हालिकुट्टी, केएम शाजी, वी अब्दुल गफूर, एन शम्सुद्दीन और पीके बशीर को कैबिनेट में जगह दी गई है। इसके अलावा मॉन्स जोसेफ, शिबू बेबी जॉन, अनूप जैकब और सीपी जॉन भी मंत्री पद की शपथ लीं।

शपथ ग्रहण में वंदे मातरम् की गूंज

शपथ ग्रहण कार्यक्रम में कांग्रेस अध्यक्ष मल्लिकार्जुन खरगे, राहुल गांधी और प्रियंका गांधी के अलावा कांग्रेस के तमाम बड़े नेता मौजूद रहे। इस शपथ ग्रहण समारोह की शुरुआत वंदे मातरम् गीत से हुई। वंदे मातरम मलयालम में गाया गया। उसके बाद जण गण मन हुआ और कार्यक्रम आगे बढ़ा

पिनराई विजय समेत मंच पर मौजूद रहे ये नेता

शपथ ग्रहण कर्नाटक के मुख्यमंत्री सिद्धारमैया और उपमुख्यमंत्री डीके शिवकुमार भी पहुंचे। तेलंगाना के सीएम रेवंत रेड्डी भी शपथ ग्रहण समारोह में मौजूद रहे। हिमाचल प्रदेश के मुख्यमंत्री सुखविंदर सिंह सुक्खू भी शपथ ग्रहण में मौजूद रहे। केरल के पूर्व मुख्यमंत्री पिनराई विजयन भी मंच पर नजर आए।

Best Bike Battery Shop in Aluva, Kerala | Green Energy Solutions

The performance of your bike depends on its battery condition during your daily commute and quick errands and long rides. The best bike battery shop in Aluva Kerala leads to a trusted destination which provides quality products and expert service and affordable pricing through its single location.

The Aluva shop has built a strong customer reputation because it provides reliable battery solutions which work for all bike and scooter types. The shop maintains its status as the most popular option in the area because it prioritizes product quality and customer happiness and delivers products which last for extended periods.

Wide Range of Bike Batteries for All Models

Every bike requires a specific type of battery based on its make, model, and usage. The shop provides complete bike battery solutions which serve various bike brands and engine specifications. The shop provides batteries which match your needs whether you own a commuter bike or sports bike or scooter.

The available batteries at this location deliver three key advantages which include high durability and fast charging and reliable performance. The customers have multiple options to choose from which allows them to meet their financial needs and product specifications.

High-Quality Products You Can Trust

The shop operates its business by using only authentic products which come from reliable manufacturers.

Every battery has been created to function effectively within the climate conditions of Kerala so it will achieve better performance and extended lifespan. The shop's dedication to maintaining high standards of excellence has established it as the leading bike battery store in Aluva, Kerala.

Expert Guidance for the Right Choice

Customers face difficulties selecting the appropriate bike battery because numerous products exist in the market. The experienced staff at this service center makes the process simple and hassle-free. The company provides basic information to customers which helps them select the best product for their specific needs based on their bike specifications and riding habits and budget restrictions.

The company aims to provide each customer with a battery which perfectly fits their requirements. The personalized service delivers two benefits because it enhances performance and extends the battery's operational time.

Fast Installation and Replacement Services

A dead bike battery can disrupt your entire day. The shop provides fast battery replacement services because customers need urgent service. Their trained technicians ensure proper installation, so your bike is ready to hit the road without delay.

Customers appreciate the fast service and professional approach, which saves both time and effort. The shop provides immediate solutions for both unexpected battery failures and scheduled replacement needs.

Affordable Pricing with Great Value

The shop distinguishes itself because of its affordable prices which create value for customers. The business maintains competitive prices through its high-quality products which remain accessible to customers. The service provides you with a budget-friendly option that allows you to maintain your desired level of quality.

The bike battery solutions from the shop provide reliable products which customers can access through regular offers and value deals to create better customer experiences.

More Than Just Bike Batteries

The store offers a variety of other goods and services in addition to its reputation as the greatest bike battery store in Aluva, Kerala. Among them are:

● Car batteries for every kind of vehicle

● Inverter systems for residences and workplaces

● Durable inverter batteries

● Inverter cards and associated parts

As a result, the store offers a full range of power solutions for both home and automobile applications.

Maintenance and Battery Care Support

The correct maintenance process serves as the essential method to extend bicycle battery lifespan. The shop provides both battery sales and essential maintenance services to its customers. Customers have the ability to schedule routine battery inspection and testing services which include maintenance work.

The team provides customers with useful battery care instructions which prevent typical problems and boost their battery efficiency. This additional assistance guarantees customers will experience sustained contentment and dependable service throughout time.

Easy Access Through Online Platform

The shop provides its customers with better accessibility through its user-friendly website which allows them to browse products and services. The online platform enables users to collect information while they conduct product comparisons and reach out to the customer support team

The shop operates a digital platform which demonstrates its dedication to contemporary customer requirements by providing users with straightforward methods to establish contact and interact with the business.

Trusted by Customers Across Aluva

The shop has developed a loyal customer base in Aluva and its neighboring areas through its business operations. The company has become a reliable market presence because of its dedication to delivering consistent product quality and providing honest service while prioritizing customer needs.

The shop delivers efficient and reliable service to its customers who need either new batteries or immediate battery replacements. The company has established a strong reputation which customers demonstrate through their positive word-of-mouth and their tendency to return.

Why Choose This Bike Battery Shop?

Here are some explanations for why this store is regarded as the top bike battery store in Aluva, Kerala:

● A large selection of bike batteries for every model

● Authentic and superior goods

● Professional advice and individualized care

● Fast replacement and installation

● Reasonably priced and excellent value

● More electricity options all under one roof

● Easy access to the internet

Because of these benefits, it is a dependable option for all local bike owners.

Conclusion

A continuous and relaxed riding experience is made possible with a dependable bike battery. Customers may purchase high-quality goods and expert support services from the top bike battery shop in Aluva, Kerala.

The Aluva shop delivers modern riders with affordable solutions while maintaining a strong commitment to customer satisfaction. The service center serves as your reliable source for complete bike battery solutions which include new battery purchases and replacement services and professional battery advice.

For more details: Visit Green Energy Solutions

Address: Green Energy Solutions, 157/2, Kallookkaran Building, Santhinagar Sreemoolanagaram P.O, Ernakulam District, Kerala 683580

Ph No: 8157946905

Published By,

Shaiju Mon K T | Click Crafters Technology

Bridal Makeup Artist Kerala | Redefining Bridal Beauty with Skin-Focused Perfection | Tony K. Michael

The weddings in Kerala showcase their sophistication through their traditional customs which create everlasting beauty. Every bride wants to achieve perfect beauty on her wedding day because the selection of an appropriate makeup artist will help her accomplish this goal. The industry recognizes Tony K. Michael as an expert who creates looks which combine natural beauty with perfect visual appeal for photography. He specializes in bridal, editorial, and celebrity makeup through his professional skills which combine artistic methods with current skin treatment techniques.Elevating Bridal Beauty in Kerala

The need for professional Bridal Makeup Artists in Kerala has increased because brides now prefer customized makeup instead of traditional heavy makeup. The modern bride requires two things which are makeup that improves her natural beauty and creates a stunning appearance in photographs and videos. Tony K. Michael understands this evolving trend and specializes in creating makeup that feels light on the skin yet looks stunning on every platform.

His signature approach focuses on skin preparation and enhancement rather than masking. The makeup process preserves the bride's natural glow which creates a perfect appearance that lasts until the wedding and its events are finished. His makeup techniques create a perfect match for traditional Kerala weddings and modern celebrations because they follow the bride's individual style and her chosen attire.

proficiency with Glass Skin Makeup, HD, and Airbrush

Tony is recognized as the top Airbrush Makeup Artist in Kerala because of his exceptional skills in advanced makeup techniques. HD makeup is designed to look perfect when viewed through high-definition cameras which makes it suitable for both weddings and professional photography. The process produces results which maintain perfect smoothness and complete refinement while eliminating all traces of imperfections.

Airbrush makeup delivers a weightless texture which maintains its effect throughout an extended period. The product has gained popularity among brides because it provides a sweat-proof and long-lasting appearance that remains intact during entire wedding events. Tony combines high-grade materials with his exacting instruments to create a natural-looking complexion that achieves a weightless effect.

The glass skin effect which has recently become a popular aesthetic trend represents one of his most distinctive artistic abilities. The technique seeks to produce a dewy finish which achieves luminous skin that reflects light. Instead of using thick, matte makeup, the approach gives brides a youthful, fresh appearance while preserving their natural radiance. Tony achieves radiant beauty through his combination of makeup skills and skincare expertise which he uses to create natural-looking results.

A Preferred Choice for Wedding and Celebrity Makeup

Artists who want to become recognized as Celebrity Makeup Artists in Kerala must prove their ability to create new designs while maintaining their professional work schedule. Tony K. Michael has built his reputation by working with diverse clients, including brides, models, and public figures. His understanding of various face shapes and skin colors and different lighting environments enables him to excel in his field.

The complete wedding service package he offers starts with his consultation service which provides trial sessions and custom wedding looks for all ceremonial events. The complete wedding package, which includes engagement ceremonies and wedding day events, features specific looks that designers developed to achieve their desired themes and costume designs. The bride achieves distinctiveness through his meticulous work which he applies to every aspect of her wedding festivities.

Personalized Approach for Every Bride

Brides have unique wedding day visions which Professional Makeup Artists in Kerala can help them achieve. Tony believes in working closely with his clients to understand their preferences, skin type, and comfort level. The makeup artist uses a personalized approach to create a look which enhances beauty and boosts confidence.

He combines traditional elements with modern elements for Hindu wedding ceremonies through his work. The Hindu Bridal Makeup expert from Kerala creates makeup which matches traditional Indian wedding attire that includes sarees and gold jewelry. The outcome creates a classic appearance which honors cultural traditions while incorporating modern fashion elements.

Why Brides Choose Tony K. Michael

There are several reasons why Tony continues to be a preferred Wedding Makeup Artist Kerala:

● Skin-Focused Techniques: The artist specializes in creating healthy skin which produces natural radiance without using heavy cosmetic products.

● Advanced Makeup Methods: The artist possesses specialized knowledge about HD makeup and airbrush techniques and glass skin makeup results.

● Customized Looks: The artist develops unique makeup designs which match the specific needs of each bride and her wedding events.

● Professional Experience: The artist works in three different fields which include bridal work and editorial work and celebrity work.

● Long-Lasting Results: The makeup product maintains its appearance throughout extended wedding celebrations.

He built a loyal customer base through his dedication to delivering high-quality work and satisfying client needs. The customer base he developed through his work has become his main source of business.

The Growing Demand for Premium Bridal Makeup in Kerala

Modern brides today have increased awareness about their existence on camera because social media platforms and high-definition photography have become popular. The industry now requires talented experts who can provide both visual appeal and technical skill to meet its current demands. The search patterns reveal that users consider Bridal Makeup Artist Kerala and Professional Makeup Artist Kerala to be essential terms for selecting the most suitable expert.

Tony K Michael provides a service that fulfills this requirement through his combination of artistic skills and exacting standards and his work ethic. His work not only enhances beauty but also captures the essence of each bride’s personality. He delivers premium makeup services to customers who want a high-end experience through his services in Kerala.

Conclusion

A wedding is one of the most memorable days in a person’s life, and every bride deserves to look and feel her best. The choice of a makeup artist who possesses both experience and expertise will determine the final results. Tony K. Michael uses his bridal and editorial and celebrity makeup skills to create new beauty standards for the state of Kerala.

Brides in Kerala who need a reliable Bridal Makeup Artist should choose him because he delivers high-quality services with elegant and innovative results. He creates both timeless and contemporary beauty results which allow brides to achieve confident looks for their special day.

For more details: Tony K. Michael / Kochi, Kerala, India

Published By,

Shaiju Mon K T / Click Crafters Technology

​Boardrooms to Film Sets: Rajesh Babu K Sooranad Expands Creative Footprint in Malayalam Cinema

Kozhikode: The inspiring journey of Rajesh Babu K Sooranad continues to gain momentum as the multi-talented creative professional strengthens his presence in the Malayalam film industry. Transitioning from a successful career in human resources to cinema, Sooranad is now making his mark as a music director, producer, singer, and filmmaker.

Hailing from Sooranad village in Kerala's Kollam district, his story reflects determination, versatility, and a deep passion for storytelling. Over the years, he has steadily built a reputation for his creative excellence while maintaining a strong foundation in management and leadership.

Strong Portfolio as Music Director

​In a significant achievement, Rajesh Babu K Sooranad has completed work on 20 films as a music director, marking a consistent rise in his musical journey. His compositions are known for their emotional depth, blending traditional Malayalam elements with modern cinematic sound.

​His notable projects include Perfume: Her Fragrance, Anandakalyanam, Binary, and Zha – The Incessant Rain, all of which have contributed to his growing recognition in the industry.

Expanding Role as Film Producer

​Alongside music, Sooranad has also emerged as a proactive film producer. Under his banner, VOC Media Private Limited, he has produced six films, supporting independent cinema and new talent.

​Among these, Perfume: Her Fragrance, Binary, and Zha – The Incessant Rain have already been released and have received attention for both their storytelling and musical quality. Meanwhile, his upcoming films—INI: The Unknown Tomorrow, Better Half, and Ennum: Forever—are currently in the post-production stage, creating anticipation among audiences and industry observers.

Directorial Debut with Ennum: Forever

​In a major milestone, Rajesh Babu K Sooranad is stepping into direction with his first directorial venture, Ennum: Forever. The project holds special significance as he is writing, directing, and producing the film himself.

​This move marks his evolution into a complete filmmaker and highlights his growing influence in the Malayalam cinema landscape.

A Voice Beyond Composition

​Beyond films, Sooranad has also made a strong impression as a singer and independent music creator. He has released 10 music albums, contributing both as composer and vocalist.

​His albums—including A Tribute to Kerala 60, Hridayame, Ponnonam, Ente Keralam, Nammude Kozhikode, Miss You Maveli, Makarachyothi, Sangeetha Samrajya, Karppooradeepam, and Perunnal Nilavu—reflect Kerala's cultural richness and emotional depth, resonating widely with audiences.

Blending Management with Creativity

​What distinguishes Sooranad is his ability to merge his HR expertise with creative execution. His background in HR and competence in Team Management have helped him efficiently coordinate productions and mentor emerging talent.

​Through his projects, he has opened doors for numerous new artists and technicians, reinforcing his reputation as a creator who believes in giving back to the industry.

Recognition and Future Outlook

​With growing recognition, including accolades for music direction and increasing visibility on OTT and theatrical platforms, Sooranad is steadily building a strong creative ecosystem. His upcoming films are expected to further strengthen his position, while his continued work in independent music keeps him connected to grassroots audiences.

A Modern Multi-Talent

​Rajesh Babu K Sooranad's journey exemplifies how passion and discipline can lead to success across multiple domains. From HR professional to filmmaker, his evolution reflects the changing face of Indian cinema.

​As Malayalam cinema continues to expand globally, his growing body of work positions him as one of the promising multi-faceted talents to watch in the coming years.

​Visit for more :

https://www.instagram.com/rajeshbabuksooranad?utm_source=qr&igsh=MTRmY2prMzduNGN5bQ==

​Face book : https://www.facebook.com/share/1E8zmcX7FD/

देश के दो राज्यों और एक केंद्र शासित प्रदेश में मतदान, केरल-असम और पुदुचेरी में वोटिंग जारी

#keralaassampuducherryvidhansabhachunav_voting

आज देश के दो राज्यों और एक केंद्र शासित प्रदेश में विधानसभा चुनाव के लिए मतदान है। आज असम, केरल और केंद्र शासित प्रदेश पुदुचेरी में विधानसभा चुनाव है। असम की 126, केरल की 140 और पुदुचेरी की 30 सीटों पर उम्मीदवारों अपनी किस्मत आज ईवीएम में कैद हो जाएगी।

असम में कुल 2.5 करोड़ मतदाता हैं, जिनमें 1.25 करोड़ पुरुष, 1.25 करोड़ महिलाएं और 343 थर्ड जेंडर मतदाता शामिल हैं। 126 सीटों पर 722 उम्मीदवार चुनाव लड़ रहे हैं। वहीं, केरल में 140 सीटों के लिए 883 उम्मीदवार मैदान में हैं। राज्य में कुल 2.71 करोड़ मतदाता हैं, जिनमें 1.32 करोड़ पुरुष, 1.39 करोड़ महिलाएं और 273 थर्ड जेंडर वोटर्स शामिल हैं। पुदुचेरी में 30 विधानसभा सीटों पर मतदान होगा, जिनमें 5 सीटें अनुसूचित जाति के लिए आरक्षित हैं। पुदुचेरी में कुल 9.50 लाख मतदाताओं में करीब 4.46 लाख पुरुष, 5.03 लाख महिलाएं और 139 थर्ड जेंडर मतदाता शामिल हैं।

पीएम मोदी ने असम के लोगों से की खास अपील

पीएम मोदी ने असम के लोगों से भी खास अपील की है। आज असम की 126 विधानसभा पर वोट डाले जा रहे हैं। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, '2026 के असम विधानसभा चुनावों के लिए मतदान प्रक्रिया शुरू होने के संदर्भ में, मैंने असम की जनता से बड़ी संख्या में बाहर आकर अपने मताधिकार का प्रयोग करने की अपील की है। मुझे उम्मीद है कि राज्य के युवा, पुरुष और महिला मतदाता पूरे उत्साह के साथ इसमें भाग लेंगे और इस चुनाव को लोकतंत्र तथा नागरिक कर्तव्य के एक उत्सव में बदल देंगे।'

पीएम मोदी की केरल के लोगों से खास अपील

केरल की 140 विधानसभा सीटों के लिए वोटिंग हो रही है। इस बीच पीएम मोदी ने केरल के लोगों से खास अपील की है। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, 'मैं केरल के लोगों से 2026 के विधानसभा चुनावों में बड़ी संख्या में मतदान करने का आह्वान करता हूं। रिकॉर्ड भागीदारी केरल की लोकतांत्रिक भावना को और अधिक मजबूती प्रदान करेगी। मैं विशेष रूप से राज्य के युवाओं और महिलाओं से आग्रह करता हूं कि वे आगे आएं और बड़ी संख्या में मतदान करें।

पुडुचेरी के मतदाताओं से लिए पीएम मोदी का पोस्ट

केंद्र शासित प्रदेश पुडुचेरी की 30 सीटों पर वोटिंग हो रही है। पीएम मोदी ने पुडुचेरी के लोगों से खास अपील की है। पीएम मोदी ने सोशल मीडिया प्लेटफॉर्म एक्स पर कहा, 'जैसे ही पुडुचेरी विधानसभा चुनाव शुरू हो रहे हैं, मैं हर मतदाता से आग्रह करता हूं कि वे बाहर निकलें और रिकॉर्ड संख्या में मतदान में हिस्सा लें। मैं विशेष रूप से हमारे युवाओं और महिला मतदाताओं से अपील करता हूं कि वे लोकतंत्र की प्रक्रिया को मजबूत करें। पुडुचेरी के भविष्य को संवारने में हर एक वोट मायने रखता है।'

Top SEO Services Company in Thrissur, Kerala| Click Crafters Technology

Businesses today require more than an online presence because they must establish their visibility and credibility while generating leads with consistency. The most effective method to achieve this goal has become Search Engine Optimization (SEO). The professional SEO service market experiences continuous growth because businesses in Kerala increasingly adopt digital platforms.Click Crafters Technology successfully maintains its position in the changing marketplace as a developing brand that provides customers with dependable digital services.Shaiju Mon K T established Click Crafters Technology ( ISO 9001:2015 certified ) in Thrissur with the goal of helping businesses create strong digital identities through their specialized digital services. The company provides SEO services together with Meta Ads and WordPress website development to existing customers who want to find the best Kerala SEO services company to support their business needs.

The Rising Importance of SEO in Kerala’s Business Landscape

The state of Kerala has experienced substantial growth through its development of internet-based enterprises and startup companies and various service providers. Every business from local shops to service-based companies and e-commerce brands aims to achieve first-page Google results. This is where SEO plays a crucial role.

Search Engine Optimization enables websites to achieve higher ranking positions on search engines which results in improved business discovery by potential customers. The team at Click Crafters Technology develops SEO solutions that achieve practical results while maintaining compliance with current search engine standards.

Their SEO services have been developed to achieve three primary objectives which include:

● Google ranking improvement

● Website traffic growth through organic methods

● Acquisition of high-quality business leads

● Increased brand recognition

● Achievement of sustainable digital expansion

The company functions as the leading option for businesses that seek the best SEO services in Kerala India.

Comprehensive SEO Services for Business Growth

Click Crafters Technology provides complete SEO services which they customize for various business sectors. Their approach begins with understanding the client’s business, target audience, and competition.

Their key SEO services include:

● Keyword Research: The process of finding valuable keywords which customers use to conduct their searches

● On-Page SEO: The process of enhancing website content through better meta tags and headings and structural optimization

● Technical SEO: The process of enhancing website performance through better speed and mobile usability and increased crawlability

● Off-Page SEO: The process of creating high-quality backlinks which boost a website's domain authority

● Local SEO: The service helps businesses achieve better rankings in local search results and on Google Maps

● Content Strategy: The development of SEO-optimized content which attracts and keeps users interested

The company provides clients with sustainable search engine rankings through techniques which drive consistent traffic development.

WordPress Website Development – Building the Foundation

A strong SEO strategy begins with a website that has been developed through proper website development. Click Crafters Technology specializes in WordPress website development, creating websites that are not only visually appealing but also optimized for search engines.

Their WordPress services include:

● Business website development

● E-commerce website creation

● SEO-friendly website design

● Mobile responsive layouts

● Fast loading websites

● Custom website solutions

A properly designed website improves user experience, reduces bounce rates, and supports better SEO performance. This integration of website development and SEO provides clients with a strong digital foundation.

Meta Ads – Boosting Reach Through Paid Campaigns

Businesses achieve fast visibility through paid advertising, while SEO delivers results that last over extended periods. Click Crafters Technology provides businesses with Meta Ads services that include Facebook and Instagram advertising to help them reach their desired audience without delay.

Their Meta Ads services include:

● Campaign planning and setup

● Audience targeting and segmentation

● Creative ad design

● Lead generation campaigns

● Website traffic campaigns

● Performance monitoring and optimization

Businesses can achieve immediate growth through Meta Ads while developing their brand identity and obtaining new customers through SEO.

A Complete Digital Growth Partner

Click Crafters Technology provides comprehensive digital solutions which serve as its main competitive advantage. Businesses do not have to depend on multiple agencies for different services. The company provides all services from website development to SEO and advertising through its unified service model.

Their integrated services include:

● WordPress website development

● Search Engine Optimization

● Facebook and Instagram Ads

● Website redesign and maintenance

● Digital marketing strategy

The unified system produces enhanced coordination which results in better outcomes and creates a smooth experience for all clients.

Supporting Businesses Across Kerala

Click Crafters Technology has been working with different types of clients which include both startups and small businesses as well as established companies. The company develops personalized solutions which are tailored to meet the specific needs of each client.

Digital marketing has become essential for Kerala businesses as they recognize its value. SEO enables their appearance in search results when customers search for their services. A professional website establishes trustworthiness while social media advertising enables businesses to reach a wider audience.

Click Crafters Technology uses these elements to help businesses achieve the following goals:

● Increase their online visibility

● Generate new business inquiries and potential customers

● Establish their brand as trustworthy

● Improve their ability to compete in the marketplace

Vision for the Future

Click Crafters Technology, led by Shaiju Mon K T, plans to expand its services to establish itself as one of Kerala's most trustworthy digital marketing companies. The company maintains its ongoing commitment to investigate contemporary developments in SEO and website development and digital advertising.

The company exists to help all businesses succeed in online marketing through its mission which delivers accessible and effective digital marketing solutions. The company exists to help all businesses succeed in online marketing through its mission which delivers accessible and effective digital marketing solutions.

Conclusion

Businesses achieve online success through their ability to establish online visibility. SEO serves three key functions because it produces organic website traffic while establishing customer trust and driving business development for extended periods. The combination of a business website which functions properly together with its advertising system delivers exceptional outcomes.

The Top SEO Services Company in Kerala India search continues for businesses which makes Click Crafters Technology the best choice because it provides dependable results through its SEO and WordPress website development and Meta Ads services.

Click Crafters Technology establishes digital presence for businesses in Kerala through its dedication to quality which results in customer satisfaction. The company helps businesses achieve online sustainable growth through its digital services.

For more details: Visit Click Crafters Technology

Ph No: 8891925986

Address: 21/811, Kadicheeni Complex, 1 Floor, Trunk Rd, North Chalakudy, Chalakudy, Kerala 680307

Fashion consulting services in Kerala, India | SG TEX AND CO

The fashion industry is changing quickly because multiple brands today choose sustainable fashion and ethical fashion. Customers who understand environmental issues now choose to buy high-quality clothing which brands make through ethical production methods. The need for sustainable clothing production in Kerala India has grown because of this trend. SG TEX AND CO operates from Chavakkad to support sustainable fashion practices which are being adopted by the fashion industry.

 

SG TEX AND CO partners with fashion brands and boutiques and designers to create sustainable clothing and high-quality womenswear and handbags and home textile products which follow responsible manufacturing methods.

Fashion Consulting Services in Kerala, India

It's difficult to launch a fashion brand. Many people have creative concepts, but they are unsure of how to turn them into completed clothing. Designers and brands can better grasp the entire garment production process with the aid of fashion consultancy services.

 

In Kerala, India, SG TEX AND CO offers fashion consulting services for:

 

●     Fashion startups

●     Boutique apparel companies

●     Designers of fashion

●     Clothing brands

●     Online retailers of apparel

●     Companies that export clothing

 

The business assists customers with product creation, production planning, fabric selection, sample, and clothing manufacture.

Premium Womenswear Manufacturer Support

The company dedicates its main business activities to producing high-quality women's clothing. Contemporary fashion brands prioritize producing high-end apparel instead of creating products for widespread distribution. Designers create premium clothing through their selection of high-quality materials and their execution of precise stitching techniques and their application of proper finishing methods and their completion of intricate design details.

 

SG TEX AND CO supports brands as a premium womenswear manufacturer by helping them develop premium dresses, tops, ethnic wear, designer wear, and boutique clothing collections. The organization provides assistance throughout the entire process starting from the first sample until the production reaches completion.

 

This support system provides essential assistance to boutique brands and designers who require high-quality garments that they need to produce in small or medium-sized quantities.

Garment Manufacturer and Custom Womenswear Maker

In Kerala, SG TEX AND CO also produces clothing and custom apparel. Custom-designed clothing is preferred by many brands over pre-made outfits. According to the client's specifications for design, fabric, size, and finishing, the company enables the creation of custom clothing.

 

Production of custom womenswear comprises:

 

●     Making patterns

●     Development of a sample

●     Sourcing of fabrics

●     Stitching, embroidery, finishing, and packing

 

Startup brands and expanding fashion companies benefit from the company's support for both small batch and large production orders.

Apparel Sourcing Company in India

The primary obstacle that fashion brands face involves their fabric and accessory sourcing needs. SG TEX AND CO operates as an apparel sourcing company which assists brands in obtaining fabrics, trims, embroidery materials, buttons, zippers, and other garment accessories from India.

 

India is recognized for its production of cotton fabrics, handloom fabrics, embroidery fabrics, and sustainable textiles. The company helps clients choose the right fabric based on their design, budget, and garment type.

 

The company provides complete fashion production services through its dual functions of apparel sourcing and garment manufacturing.

Boutique Clothing Manufacturer and Hand Embroidery Garment Production

Boutique clothing production requires more attention to detail compared to mass garment production. SG TEX AND CO works as a boutique clothing manufacturer supporting designers and boutique brands.

 

The company offers production services for hand embroidery on garments. Hand embroidery is widely used in designer wear, bridal wear, ethnic wear, and premium garments. Skilled workers do detailed embroidery work carefully to maintain quality and design accuracy.

 

Hand embroidery adds more value to garments and makes them unique, which is very important for boutique fashion brands.

Sustainable Apparel Production Support

Fashion brands today direct their efforts toward sustainable fashion and slow fashion production methods. The sustainable production of apparel requires brands to use responsible fabric sourcing and implement small batch production methods while minimizing waste and following ethical manufacturing practices.

 

SG TEX AND CO supports sustainable apparel production by focusing on quality garments instead of mass production. This solution provides significant assistance to sustainable fashion brands and environmentally friendly clothing brands.

 

The company supports brands that want to produce handmade garments, slow fashion collections, and sustainable clothing products.

Handbag Manufacturer and Home Textile Manufacturing Company

In addition to clothing, SG TEX AND CO is a handbag and home textile maker. A lot of fashion firms seek to include handbags and home textiles to their product line.

 

The business produces:

 

●     Handbags made of fabric

●     Personalized purses

●     Covers for cushions

●     Textile goods for the home

●     Accessories made of textiles

 

This makes it easier for fashion brands to collaborate with a single business to manufacture various textiles and fashion items.

Complete Fashion Production Partner

SG TEX AND CO is more than just a clothing company. The business serves as a full-service partner in fashion production by offering:

 

●     Consulting services for fashion

●     High-end production of women's clothing

●     Production of clothing

●     Production of custom womenswear

●     Services for sourcing clothing

●     Manufacturing of boutique apparel

●     Production of clothing via hand embroidery

●     Eco-friendly clothing manufacturing

●     Production of handbags

●     Manufacturing textiles at home

 

Because of this, the business is highly beneficial to up-and-coming fashion firms and designers that require full support from conception to finished product.

Conclusion

The fashion industry requires proper planning, fabric sourcing, sampling, production, and quality control. Multiple fashion brands experience failure because they lack adequate production backing and operational support. The fashion consulting services assist brands in learning about the entire garment production method while they protect themselves from production errors.

 

SG TEX AND CO, located in Chavakkad, Kerala, provides fashion consulting services in Kerala, India along with garment manufacturing, premium womenswear production, apparel sourcing, boutique clothing manufacturing, hand embroidery garment production, sustainable apparel production, handbag manufacturing, and home textile manufacturing.

 

The company establishes itself as a trustworthy fashion consulting and garment manufacturing partner for fashion brands by providing design assistance and complete production support.

 

SG TEX AND CO provides fashion consulting services to fashion brands and designers in Kerala India through their professional guidance and garment production support and complete fashion manufacturing solutions.

 

For More Details : SG TEX, 17/140, Business Tower, Chavakkad, Thrissur , Kerala, 680506. Ph No: 9769286666. Website: www.sgtexco.com

 

Published By,

Shaiju Mon K T | Click Crafters Technology

 

 

Premium Womenswear Manufacturer in Kerala, India | SG TEX AND CO

The fashion industry is experiencing rapid growth which leads multiple fashion brands to search for dependable clothing manufacturers in India. Premium womenswear manufacturing stands as one of the essential divisions that make up the fashion industry. Modern brands now emphasize three key elements which include product quality, distinctive design patterns, and fabric comfort combined with flawless product finishing. The business of SG TEX AND CO operates as a major premium womenswear manufacturing company in Kerala which delivers its services across India.SG TEX AND CO operates from its Chavakkad location to deliver multiple services which include premium womenswear manufacturing, garment production, hand embroidery garment production, apparel sourcing, handbag manufacturing, and home textile manufacturing to fashion brands and boutiques and designers who operate in India and international markets.

Growing Demand for Premium Womenswear Manufacturing in India

The demand for high-end womenswear has grown substantially during the past few years. Customers now want to buy high-quality clothing instead of purchasing fast fashion items. The premium clothing sector establishes its product standards through an assessment of material excellence and stitching expertise and finishing techniques and distinct design elements. Fashion brands currently seek trustworthy manufacturers who produce high-quality womenswear in Kerala India.

Kerala has a reputation for producing skilled workers who specialize in tailoring and textile and embroidery and garment manufacturing. Kerala-based garment manufacturers attract fashion brands because they produce premium clothing through precise work and high-quality results.

SG TEX AND CO provides garment manufacturing services which assist premium fashion brands through their business operations.

Premium Womenswear Manufacturing Services

The business of SG TEX AND CO operates primarily through its production of high-quality women's clothing which it creates for fashion retailers and boutique stores. The company manufactures different types of womenswear including dresses, tops, ethnic wear, boutique collections, designer wear, and custom-designed garments.

The company supports clients from the beginning stage itself. Their services include:

● Design support

● Pattern making

● Sample development

● Fabric sourcing

● Garment production

● Hand embroidery work

● Quality checking

● Packing and finishing

● Cut and make services

The full process enables fashion brands to develop their clothing collections because they do not need to handle any production-related problems.

Custom Womenswear Production for Fashion Brands

Many fashion designers and boutique owners want custom garment production in small quantities. SG TEX AND CO accepts both small orders and large production orders because not all manufacturers do so.

This service provides multiple advantages to:

● Boutique clothing brands

● Startup fashion brands

● Online clothing brands

● Fashion designers

● Export garment brands

The custom womenswear manufacturing process includes custom designs and custom fabrics and custom embroidery and custom sizes which match the brand requirements.

Hand Embroidery and Premium Garment Finishing

Premium womenswear requires more than sewing because it needs hand embroidery and detailed work and final production inspection. The hand embroidery service of SG TEX AND CO enables premium garment production which enhances the value of these high-quality products.

Hand embroidery is commonly used in the following fashion categories:

● Designer wear

● Bridal wear

● Boutique collections

● Ethnic wear

● Premium fashion garments

The company employs trained personnel who execute complex embroidery work with precision to achieve high-quality results and authentic design representation.

Apparel Sourcing and Fabric Support

Fashion brands face major difficulties because they need to find both fabrics and materials for their operations. SG TEX AND CO offers apparel sourcing services which assist clients in finding fabrics and trims and accessories and all other materials that they need for their garment production needs.

India is recognized as a source of cotton fabrics and embroidery fabrics and sustainable fabrics and handloom fabrics. SG TEX AND CO assists clients in selecting suitable fabrics that match their design requirements and budget constraints. In India similar fabrics are available in different quality. our experts ensure that the top quality fabrics and trims/ accessories are sourced.

The company operates as a total fashion production partner because it provides more services than just manufacturing garments.

Sustainable and Slow Fashion Production

Today many fashion brands are focusing on sustainable fashion and slow fashion production. Slow fashion means producing quality garments in small quantities with less waste and better working conditions.

SG TEX AND CO supports sustainable apparel production and slow fashion brands by focusing on quality production instead of mass production. They support brands that want eco-friendly clothing, handmade garments, and ethical fashion production.

Many premium fashion brands choose to work with smaller garment manufacturers who focus on producing high-quality products.

Handbags and Home Textile Manufacturing

SG TEX AND CO produces premium womenswear and various products that include handbags and home textile items. Fashion brands show interest in expanding their product lines to include handbags and cushion covers and textile products.

The company supports clients in manufacturing:

● Fabric handbags

● Custom handbags

● Cushion covers

● Home textile products

● Textile accessories

This enables fashion brands to use a single production partner for all their product needs.

Premium Womenswear Manufacturer in Kerala, India

The fashion industry in Kerala India needs premium womenswear manufacturers who meet standards of quality and reliability and production flexibility and industry experience. SG TEX AND CO provides all these services and supports brands from design to final production.

The company in Kerala uses its location to access skilled workers who include embroidery workers and tailoring unit staff and textile resources. This enables them to deliver premium garments to their clients while maintaining high-quality standards.

The company serves Indian fashion brands and international clients who require garment manufacturing and apparel sourcing services from India.

Conclusion

The fashion industry requires dependable production partners who possess expertise in high-end fashion and garment quality and bespoke clothing manufacturing. SG TEX AND CO operates from Chavakkad, Kerala, as a developing premium womenswear manufacturer that provides support to various fashion brands and boutiques and designers and apparel companies in India.

The company expands its capabilities as a full fashion production partner through its offerings of premium garment manufacturing and custom womenswear production and hand embroidery garment production and apparel sourcing and handbag manufacturing and home textile production services.

SG TEX AND CO delivers dependable and high-quality professional garment manufacturing services to fashion brands that require a premium womenswear manufacturer based in Kerala India.

For More Details : SG TEX, 17/140, Business Tower, Chavakkad, Thrissur , Kerala, 680506. Ph No: 9769286666. Website: www.sgtexco.com

Published By,

Shaiju Mon K T | Click Crafters Technology

'द केरल स्टोरी-2' को ज्यादा दर्शक न मिलना 'अच्छी खबर', राहुल गांधी बोले-फिल्मों का इस्तेमाल प्रचार के लिए हो रहा

#rahulgandhisaysthekeralastory2notattractingmanyviewersisgood_news

कांग्रेस नेता राहुल गांधी ने कहा है कि यह "अच्छी खबर" है कि विवादित फिल्म 'द केरल स्टोरी-2 गोज बियॉन्ड' को ज्यादा दर्शक नहीं मिल रहे हैं। राहुल गांधी ने शुक्रवार को कुट्टिक्कानम के मारियन कॉलेज में छात्रों से बातचीत करते हुए ये बयान दिया।

फिल्मों को दुष्प्रचार का साधन बनाए जाने के बारे में एक छात्र के प्रश्न का उत्तर देते हुए गांधी ने ‘केरल स्टोरी-2 गोज बियॉन्ड’ पर अपने विचार साझा किए। राहुल गांधी ने कहा कि अच्छी खबर यह है कि ‘केरल स्टोरी’ वाले सिनेमाघरों में सीट खाली पड़ी हैं, और इसे कोई देख नहीं रहा है। यह दिखाता है कि ऐसे लोग हैं, जिनमें से अधिकांश को केरल और उसकी परंपराओं तथा संस्कृति की समझ नहीं है।

फिल्मों-टेलीविजन और मीडिया का राजनीतिक इस्तेमाल

राहुल के अनुसार, फिल्मों, टेलीविजन और मीडिया को तेजी से ‘हथियार’ के रूप में इस्तेमाल किया जा रहा है। राहुल गांधी ने कहा कि सिनेमा, टेलीविजन और मीडिया का इस्तेमाल राजनीतिक संदेश फैलाने के लिए तेजी से किया जा रहा है। उन्होंने कहा, “इसका इस्तेमाल ठीक इसी उद्देश्य से किया जाता है— लोगों को बदनाम करने, उन्हें समाज से अलग करने और समाज में फूट डालने के लिए, ताकि कुछ लोगों को फायदा हो और दूसरों को नुकसान। भारत भी कुछ ऐसा ही बन चुका है।

इस तरह के घटनाक्रम के लिए बड़ी खर्च हो रहा-राहुल गांधी

कांग्रेस सांसद का दावा है किया कि इस तरह के घटनाक्रम देश के लिए हानिकारक थे और इस उद्देश्य के लिए बड़ी मात्रा में धन खर्च किया जा रहा था। उन्होंने कहा कि अगर कोई इंसान किसी खास तरह की फिल्म बनाना चाहता है, मीडिया में कुछ कहना चाहता है, या किसी खास आइडिया को डिफेंड करना चाहता है, तो उन पर हमला किया जाता है और अक्सर उन्हें बोलने नहीं दिया जाता। राहुल ने कहा कि मैं यह हर समय महसूस करता हूं। दूसरी तरफ, कुछ कहानियों को लोग जितना चाहें उतना फैला सकते हैं और उनका कुछ नहीं होता।

देश की शिक्षा प्रणाली पर वैचारिक दबाव-राहुल गांधी

राहुल गांधी ने कहा कि केरल में समृद्ध सांस्कृतिक परंपराएं हैं और उन्होंने छात्रों से आग्रह किया कि वे इन परंपराओं से जुड़े रहें और साथ ही दुनिया के अन्य हिस्सों से भी सीखें। उन्होंने यह भी चिंता व्यक्त की कि देश की शिक्षा प्रणाली वैचारिक दबाव का सामना कर रही है। उन्होंने कहा, “यदि आप विश्वविद्यालयों के कुलपतियों को देखें, तो उनमें से बड़ी संख्या में नियुक्तियां केवल इसलिए की गई हैं क्योंकि वे आरएसएस या किसी विशेष विचारधारा का हिस्सा हैं। शिक्षा प्रणाली पर वैचारिक दबाव है। शिक्षा किसी विशेष विचारधारा तक सीमित नहीं होनी चाहिए, विशेष रूप से आरएसएस के विभाजनकारी दृष्टिकोण तक तो बिल्कुल नहीं।”